Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L) Recombinant Protein | Bcl2L recombinant protein

Recombinant B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L)

Gene Names
Bcl2l1; BclX; Bcl2l; bcl-x; Bcl-XL; Bcl(X)L; bcl2-L-1
Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L); Recombinant B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L); Bcl2L recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-SQSNRELVV DFLSYKLSQK GYSWSQFSDV EENRTEAPEE TEAERETPSA INGNPSWHLA DSPAVNGATG HSSSLDAREV IPMAAVKQAL REAGDEFELR YRRAFSDLTS QLHITPGTAY QSFEQVVNEL FRDGVNWGRI VAFFSFGGAL CVESVDKEMQ VLVSRIASWM ATYLNDHLEP WIQENGGWDT FVDLYGNNAA AESRKGQERF NR
Sequence Length
233
Applicable Applications for Bcl2L recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Mus musculus (Mouse)
Expression System
Prokaryotic expression
Residues
Ser2~Arg212 (Accession # Q64373) with two N-terminal Tags, His-tag and T7-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.6kDa
NCBI Official Full Name
bcl-2-like protein 1
NCBI Official Synonym Full Names
BCL2-like 1
NCBI Official Symbol
Bcl2l1
NCBI Official Synonym Symbols
BclX; Bcl2l; bcl-x; Bcl-XL; Bcl(X)L; bcl2-L-1
NCBI Protein Information
bcl-2-like protein 1; apoptosis regulator Bcl-X; B-cell leukemia/lymphoma x; anti-apoptosis regulatory protein
UniProt Protein Name
Bcl-2-like protein 1
UniProt Gene Name
Bcl2l1
UniProt Synonym Gene Names
Bcl2l; Bclx; Bcl2-L-1
UniProt Entry Name
B2CL1_MOUSE

NCBI Description

This gene encodes a member of the Bcl-2 family of apoptosis regulators. The encoded protein is localized to the inner and outer mitochondrial membranes and regulates the programmed cell death pathway during development and tissue homeostasis. This protein binds to voltage-dependent anion channels in the outer mitochondrial membrane to facilitate the uptake of calcium ions. Mice embryos lacking this gene survived for two weeks and exhibited cell death of immature hematopoietic cells and neurons. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Jan 2014]

Uniprot Description

Bcl-xL: an antiapoptotic member of the Bcl-2 family. Located at the outer mitochondrial membrane and regulates outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are potent inducers of cell apoptosis. Two alternatively spliced isoforms have been reported.

Protein type: Membrane protein, integral; Apoptosis; Mitochondrial; Autophagy

Cellular Component: mitochondrial envelope; centrosome; mitochondrion; integral to membrane; cytosol; mitochondrial outer membrane; cytoskeleton; membrane; mitochondrial inner membrane; mitochondrial membrane; cytoplasm; nucleolus; synapse; intracellular; cytoplasmic vesicle; nucleus; cell junction

Molecular Function: BH domain binding; identical protein binding; protein binding; protein homodimerization activity; protein heterodimerization activity; caspase inhibitor activity; BH3 domain binding; protein kinase binding

Biological Process: positive regulation of apoptosis; apoptosis; cytokinesis; negative regulation of caspase activity; cellular process regulating host cell cycle in response to virus; germ cell development; regulation of apoptosis; response to radiation; regulation of mitochondrial membrane potential; ovarian follicle development; positive regulation of cell proliferation; negative regulation of neuron apoptosis; release of cytochrome c from mitochondria; in utero embryonic development; mitotic cell cycle checkpoint; response to virus; male gonad development; suppression by virus of host apoptosis; cell proliferation; neuron apoptosis; fertilization; DNA damage response, signal transduction resulting in induction of apoptosis; response to cytokine stimulus; response to cycloheximide; spermatogenesis; regulation of mitochondrial membrane permeability; growth; negative regulation of apoptosis

Research Articles on Bcl2L

Similar Products

Product Notes

The Bcl2L bcl2l1 (Catalog #AAA2009480) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the Bcl2L bcl2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and T7-tag, its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-SQS NRELVV DFLSYKLSQK GYSWSQFSDV EENRTEAPEE TEAERETPSA INGNPSWHLA DSPAVNGATG HSSSLDAREV IPMAAVKQAL REAGDEFELR YRRAFSDLTS QLHITPGTAY QSFEQVVNEL FRDGVNWGRI VAFFSFGGAL CVESVDKEMQ VLVSRIASWM ATYLNDHLEP WIQENGGWDT FVDLYGNNAA AESRKGQERF NR. It is sometimes possible for the material contained within the vial of "B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.