Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of IL7R alpha expression in 22RV1 whole cell lysates (lane 1). IL7R alpha at 70KD was detected using rabbit anti- IL7R alpha Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit IL7R Polyclonal Antibody | anti-IL7R antibody

Anti-IL7R alpha Antibody

Gene Names
IL7R; ILRA; CD127; IL7RA; CDW127; IL-7R-alpha
Reactivity
Human, Rat
No cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
IL7R; Polyclonal Antibody; Anti-IL7R alpha Antibody; CD 127; CD127; CD127 antigen; IL 7R alpha; IL-7R-alpha; IL 7R; IL-7RA; IL7RA; IL7Ralpha; ILRA; Interleukin 7 receptor; P16871; Interleukin-7 receptor subunit alpha; interleukin 7 receptor; anti-IL7R antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
459
Applicable Applications for anti-IL7R antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat
Tested Species:In-house tested species with positive results.
Other applications have not been tested.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of IL7R alpha expression in 22RV1 whole cell lysates (lane 1). IL7R alpha at 70KD was detected using rabbit anti- IL7R alpha Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of IL7R alpha expression in 22RV1 whole cell lysates (lane 1). IL7R alpha at 70KD was detected using rabbit anti- IL7R alpha Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-IL7R antibody
Rabbit IgG polyclonal antibody for Interleukin-7 receptor subunit alpha (IL7R) detection.
Background: The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).
References
1. "Entrez Gene: IL7R interleukin 7 receptor".
2. Kroemer RT, Richards WG (December 1996). "Homology modeling study of the human interleukin-7 receptor complex".Protein Eng. 9 (12): 1135-42.
3. O'Doherty C, Alloza I, Rooney M, Vandenbroeck K (November 2009). "IL7RA polymorphisms and chronic inflammatory arthropathies". Tissue Antigens 74 (5): 429-31.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,724 Da
NCBI Official Full Name
interleukin-7 receptor subunit alpha
NCBI Official Synonym Full Names
interleukin 7 receptor
NCBI Official Symbol
IL7R
NCBI Official Synonym Symbols
ILRA; CD127; IL7RA; CDW127; IL-7R-alpha
NCBI Protein Information
interleukin-7 receptor subunit alpha
UniProt Protein Name
Interleukin-7 receptor subunit alpha
Protein Family
UniProt Gene Name
IL7R
UniProt Synonym Gene Names
IL-7 receptor subunit alpha; IL-7R subunit alpha; IL-7R-alpha; IL-7RA
UniProt Entry Name
IL7RA_HUMAN

NCBI Description

The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found. [provided by RefSeq, Dec 2015]

Uniprot Description

IL7R: Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP). Defects in IL7R are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell- positive/NK-cell-positive (T(-)B(+)NK(+) SCID). A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. Genetic variations in IL7R are a cause of susceptibility to multiple sclerosis type 3 (MS3). A multifactorial, inflammatory, demyelinating disease of the central nervous system. Sclerotic lesions are characterized by perivascular infiltration of monocytes and lymphocytes and appear as indurated areas in pathologic specimens (sclerosis in plaques). The pathological mechanism is regarded as an autoimmune attack of the myelin sheat, mediated by both cellular and humoral immunity. Clinical manifestations include visual loss, extra-ocular movement disorders, paresthesias, loss of sensation, weakness, dysarthria, spasticity, ataxia and bladder dysfunction. Genetic and environmental factors influence susceptibility to the disease. A polymorphism at position 244 strongly influences susceptibility to multiple sclerosis. Overtransmission of the major 'C' allele coding for Thr-244 is detected in offspring affected with multiple sclerosis. In vitro analysis of transcripts from minigenes containing either 'C' allele (Thr-244) or 'T' allele (Ile-244) shows that the 'C' allele results in an approximately two-fold increase in the skipping of exon 6, leading to increased production of a soluble form of IL7R. Thus, the multiple sclerosis associated 'C' risk allele of IL7R would probably decrease membrane-bound expression of IL7R. As this risk allele is common in the general population, some additional triggers are probably required for the development and progression of MS. Belongs to the type I cytokine receptor family. Type 4 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 5p13

Cellular Component: plasma membrane

Molecular Function: antigen binding; interleukin-7 receptor activity; protein binding

Biological Process: cell surface receptor linked signal transduction; immune response; regulation of DNA recombination; signal transduction

Disease: Severe Combined Immunodeficiency, Autosomal Recessive, T Cell-negative, B Cell-positive, Nk Cell-positive

Research Articles on IL7R

Similar Products

Product Notes

The IL7R il7r (Catalog #AAA178448) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-IL7R alpha Antibody reacts with Human, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's IL7R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat Tested Species:In-house tested species with positive results. Other applications have not been tested. Researchers should empirically determine the suitability of the IL7R il7r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL7R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.