Western Blot (WB)
(KLF2 monoclonal antibody (M09), clone 1D12. Western Blot analysis of KLF2 expression in IMR-32.)
Mouse KLF2 Monoclonal Antibody | anti-KLF2 antibody
KLF2 (Kruppel-like Factor 2 (lung), LKLF) (FITC)
Gene Names
KLF2; LKLF
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
KLF2; Monoclonal Antibody; KLF2 (Kruppel-like Factor 2 (lung); LKLF) (FITC); Kruppel-like Factor 2 (lung); LKLF; anti-KLF2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D12
Specificity
Recognizes KLF2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-KLF2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
KLF2 (NP_057354, 263aa-350aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(KLF2 monoclonal antibody (M09), clone 1D12. Western Blot analysis of KLF2 expression in IMR-32.)
Western Blot (WB)
(KLF2 monoclonal antibody (M09), clone 1D12. Western Blot analysis of KLF2 expression in IMR-32.)
Related Product Information for anti-KLF2 antibody
Mouse monoclonal antibody raised against a partial recombinant KLF2.
Product Categories/Family for anti-KLF2 antibody
References
1. Kruppel-like Factor 2 Modulates CCR5 Expression and Susceptibility to HIV-1 Infection. Richardson MW, Jadlowsky J, Didigu CA, Doms RW, Riley JL.J Immunol. 2012 Oct 15;189(8):3815-21. doi: 10.4049/jimmunol.1201431. Epub 2012 Sep 17.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
Krueppel-like factor 2
NCBI Official Synonym Full Names
Kruppel like factor 2
NCBI Official Symbol
KLF2
NCBI Official Synonym Symbols
LKLF
NCBI Protein Information
Krueppel-like factor 2
UniProt Protein Name
Krueppel-like factor 2
Protein Family
UniProt Gene Name
KLF2
UniProt Synonym Gene Names
LKLF
NCBI Description
This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is expressed early in mammalian development and is found in many different cell types. The protein acts to bind the CACCC box found in the promoter of target genes to activate their transcription. It plays a role in many processes during development and disease including adipogenesis, embryonic erythropoiesis, epithelial integrity, inflammation and t-cell viability. [provided by RefSeq, Mar 2017]
Uniprot Description
Transcription factor that binds to the CACCC box in the promoter of target genes such as HBB/beta globin or NOV and activates their transcription.
Research Articles on KLF2
Similar Products
Product Notes
The KLF2 klf2 (Catalog #AAA6178133) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KLF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLF2 klf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
