Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Leptin Picoband antibody, MBS178368, Western blottingAll lanes: Anti LEP/leptin (MBS178368) at 0.5ug/mlWB: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 16KDObserved bind size: 16KD )

anti-Mouse Leptin Polyclonal Antibody | anti-Lep antibody

Anti-Leptin Antibody

Gene Names
Lep; ob; obese
Reactivity
Mouse
Applications
Western Blot, ELISA
Purity
Immunogen Affinity Purified
Synonyms
Leptin; Polyclonal Antibody; Anti-Leptin Antibody; FLJ94114; LEP; LEP_HUMAN; LEPD; Leptin (murine obesity homolog); Leptin (obesity homolog; mouse); Leptin Murine Obesity Homolog; Leptin Precursor Obesity Factor; OB; Obese Protein; Obese; mouse; homolog of; Obesity; Obesity factor; Obesity homolog mouse; Obesity Murine Homolog Leptin; OBS; OTTHUMP00000212285; leptin; anti-Lep antibody
Ordering
For Research Use Only!
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
167
Applicable Applications for anti-Lep antibody
Western Blot (WB), ELISA (EIA)
Application Notes
ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of mouse Leptin (74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH), different from the related human sequence by five amino acids, and from the related rat sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Leptin Picoband antibody, MBS178368, Western blottingAll lanes: Anti LEP/leptin (MBS178368) at 0.5ug/mlWB: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 16KDObserved bind size: 16KD )

Western Blot (WB) (Anti- Leptin Picoband antibody, MBS178368, Western blottingAll lanes: Anti LEP/leptin (MBS178368) at 0.5ug/mlWB: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 16KDObserved bind size: 16KD )
Related Product Information for anti-Lep antibody
Description: Rabbit IgG polyclonal antibody for Leptin(LEP) detection. Tested with WB, ELISA in Mouse.

Background: Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.
References
1. Halaas JL, Gajiwala KS, Maffei M, Cohen SL, Chait BT, Rabinowitz D, Lallone RL, Burley SK, Friedman JM (July 1995). "Weight-reducing effects of the plasma protein encoded by the obese gene". Science 269 (5223): 543-6. 2. Maffei M, Halaas J, Ravussin E, Pratley RE, Lee GH, Zhang Y, Fei H, Kim S, Lallone R, Ranganathan S (November 1995). "Leptin levels in human and rodent: measurement of plasma leptin and ob RNA in obese and weight-reduced subjects". Nat. Med. 1 (11): 1155-61. 3. Pan H, Guo J, Su Z (May 2014). "Advances in understanding the interrelations between leptin resistance and obesity".Physiology & Behavior 130: 157-169.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,709 Da
NCBI Official Full Name
leptin
NCBI Official Synonym Full Names
leptin
NCBI Official Symbol
Lep
NCBI Official Synonym Symbols
ob; obese
NCBI Protein Information
leptin
UniProt Protein Name
Leptin
Protein Family
UniProt Gene Name
Lep
UniProt Synonym Gene Names
Ob
UniProt Entry Name
LEP_MOUSE

Uniprot Description

leptin: May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass. Defects in LEP may be a cause of obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. Belongs to the leptin family.

Protein type: Cell development/differentiation; Secreted, signal peptide; Hormone; Secreted

Cellular Component: cytoplasm; extracellular region; extracellular space

Molecular Function: growth factor activity; hormone activity; peptide hormone receptor binding; protein binding; receptor binding

Biological Process: adult feeding behavior; angiogenesis; bile acid metabolic process; central nervous system neuron development; cholesterol metabolic process; eating behavior; energy reserve metabolic process; fatty acid beta-oxidation; fatty acid catabolic process; glucose homeostasis; glucose metabolic process; glycerol biosynthetic process; hormone metabolic process; insulin secretion; interleukin-12 production; interleukin-6 production; intestinal absorption; leptin-mediated signaling pathway; leukocyte tethering or rolling; lipid metabolic process; negative regulation of apoptosis; negative regulation of appetite; negative regulation of autophagy; negative regulation of glucose import; negative regulation of metabolic process; negative regulation of transcription from RNA polymerase II promoter; negative regulation of vasoconstriction; ovulation from ovarian follicle; phagocytosis; placenta development; positive regulation of cell proliferation; positive regulation of developmental growth; positive regulation of insulin receptor signaling pathway; positive regulation of ion transport; positive regulation of JAK-STAT cascade; positive regulation of MAPKKK cascade; positive regulation of myeloid cell differentiation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein import into nucleus; positive regulation of protein kinase B signaling cascade; positive regulation of T cell proliferation; positive regulation of TOR signaling pathway; positive regulation of tumor necrosis factor production; positive regulation of tyrosine phosphorylation of Stat3 protein; prostaglandin secretion; regulation of angiogenesis; regulation of blood pressure; regulation of bone remodeling; regulation of cell cycle; regulation of cholesterol absorption; regulation of endothelial cell proliferation; regulation of fat cell differentiation; regulation of gluconeogenesis; regulation of insulin secretion; regulation of metabolic process; regulation of natural killer cell activation; regulation of natural killer cell mediated cytotoxicity; regulation of natural killer cell proliferation; regulation of nitric-oxide synthase activity; regulation of protein amino acid phosphorylation; regulation of steroid biosynthetic process; response to dietary excess; response to insulin stimulus; sexual reproduction; signal transduction; T cell differentiation; tyrosine phosphorylation of STAT protein

Research Articles on Lep

Similar Products

Product Notes

The Lep lep (Catalog #AAA178368) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Leptin Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Leptin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). ELISA Concentration: 0.1-0.5ug/ml Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the Lep lep for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Leptin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.