Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Rab11A Picoband antibody, MBS178147, Western blottingAll lanes: Anti Rab11A (MBS178147) at 0.5ug/mlWB: A549 Whole Cell Lysate at 40ugPredicted bind size: 24KD,60KDObserved bind size: 24KD,60KD )

anti-Human Rab11A Polyclonal Antibody | anti-RAB11A antibody

Anti-Rab11A Antibody

Gene Names
RAB11A; YL8
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Rab11A; Polyclonal Antibody; Anti-Rab11A Antibody; Ras-related protein Rab-11A; MGC1490; Rab 11; Rab 11A; RAB 11A member oncogene family; RAB 11A; member oncogene family; Rab-11; RAB11 A; RAB11; RAB11A; RAB11A member RAS oncogene family; Ras related protein Rab 11A; Ras related protein Rab11A; YL 8; YL8; member RAS oncogene family; anti-RAB11A antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
155
Applicable Applications for anti-RAB11A antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Rab11A Picoband antibody, MBS178147, Western blottingAll lanes: Anti Rab11A (MBS178147) at 0.5ug/mlWB: A549 Whole Cell Lysate at 40ugPredicted bind size: 24KD,60KDObserved bind size: 24KD,60KD )

Western Blot (WB) (Anti- Rab11A Picoband antibody, MBS178147, Western blottingAll lanes: Anti Rab11A (MBS178147) at 0.5ug/mlWB: A549 Whole Cell Lysate at 40ugPredicted bind size: 24KD,60KDObserved bind size: 24KD,60KD )
Related Product Information for anti-RAB11A antibody
Description: Rabbit IgG polyclonal antibody for Ras-related protein Rab-11A(RAB11A) detection. Tested with WB in Human.

Background: Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.
References
1. Bao, X., Faris, A. E., Jang, E. K., Haslam, R. J. Molecular cloning, bacterial expression and properties of Rab31 and Rab32: new blood platelet Rab proteins. Europ. J. Biochem. 269: 259-271, 2002. 2. "Entrez Gene: RAB11A RAB11A, member RAS oncogene family" 3. Espevik T, Husebye H, Aune MH, Stenvik J; Samstad E, Skjeldal F, Halaas O, Nilsen NJ, Stenmark H, Latz E, Lien E, Mollnes TE, Bakke O (October 2010). "The Rab11a GTPase controls Toll-like receptor 4-induced activation of interferon regulatory factor-3 on phagosomes". Immunity 33 (4): 583-596.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,659 Da
NCBI Official Full Name
ras-related protein Rab-11A isoform 2
NCBI Official Synonym Full Names
RAB11A, member RAS oncogene family
NCBI Official Symbol
RAB11A
NCBI Official Synonym Symbols
YL8
NCBI Protein Information
ras-related protein Rab-11A
UniProt Protein Name
Ras-related protein Rab-11A
Protein Family
UniProt Gene Name
RAB11A
UniProt Synonym Gene Names
RAB11; Rab-11
UniProt Entry Name
RB11A_HUMAN

NCBI Description

The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Uniprot Description

RAB11A: Regulates endocytic recycling. May exert its functions by interacting with multiple effector proteins in different complexes. Acts as a major regulator of membrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma membrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma membrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral membranes. Interacts with RIP11 and STXBP6. Interacts with SGSM1, SGSM2 and SGSM3. Interacts with EXOC6 in a GTP- dependent manner. Interacts with RAB11FIP1, RAB11FIP2, RAB11FIP3 (via its C-terminus) and RAB11FIP4. Interacts with EVI5; EVI5 and RAB11FIP3 may be mutually exclusive and compete for binding RAB11A. Interacts with SPE39//C14orf133. Interacts with MYO5B. Found in a complex with MYO5B and CFTR. Interacts with NPC1L1. Interacts (GDP-bound form) with ZFYVE27. Interacts with BIRC6/bruce. Belongs to the small GTPase superfamily. Rab family.

Protein type: Motility/polarity/chemotaxis; G protein; G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: 15q22.31

Cellular Component: axon; centrosome; cleavage furrow; cytoplasmic vesicle; cytoplasmic vesicle membrane; cytosol; Golgi apparatus; kinetochore microtubule; mitochondrion; multivesicular body; perinuclear region of cytoplasm; phagocytic vesicle; plasma membrane; protein complex; recycling endosome; recycling endosome membrane; spindle pole; trans-Golgi network; transport vesicle; vesicle

Molecular Function: GTP binding; GTPase activity; microtubule binding; myosin V binding; protein binding; syntaxin binding

Biological Process: astral microtubule organization and biogenesis; cytokinesis; establishment of vesicle localization; intracellular protein transport; melanosome transport; metabolic process; mitotic metaphase plate congression; neurite development; nucleocytoplasmic transport; plasma membrane to endosome transport; positive regulation of axon extension; regulation of long-term neuronal synaptic plasticity; regulation of protein transport; renal water homeostasis; small GTPase mediated signal transduction; vesicle-mediated transport

Research Articles on RAB11A

Similar Products

Product Notes

The RAB11A rab11a (Catalog #AAA178147) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Rab11A Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Rab11A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the RAB11A rab11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Rab11A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.