FUT1 Polyclonal Antibody | anti-FUT1 antibody

Anti-FUT1 Antibody

Cat. Num. AAA178100

• Gene Names: FUT1; H; HH; HSC
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: FUT1; Polyclonal Antibody; Anti-FUT1 Antibody; Galactoside 2-alpha-L-fucosyltransferase 1; 2)FT 1; 2-alpha-L-fucosyltransferase; Alpha (1 2) fucosyltransferase; Alpha(1 2)FT 1; Alpha(1; Blood group H alpha 2-fucosyltransferase; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); Fucosyltransferase 1; FUT1_HUMAN; Galactoside 2 alpha L fucosyltransferase; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H; HH; HSC; Para Bombay phenotype; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase; H blood group); anti-FUT1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 365

• Applicable Applications for anti-FUT1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- FUT1 Picoband antibody, MBS178100, Western blottingAll lanes: Anti FUT1 (MBS178100) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 50KDObserved bind size: 50KD)

Immunohistochemistry (IHC)

(Anti- FUT1 Picoband antibody, MBS178100, IHC(P)IHC(P): Mouse Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- FUT1 Picoband antibody, MBS178100, IHC(P)IHC(P): Rat Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- FUT1 Picoband antibody, MBS178100, IHC(P)IHC(P): Human Mammary Cancer Tissue )

Related Product Information for anti-FUT1 antibody

Description: Rabbit IgG polyclonal antibody for Galactoside 2-alpha-L-fucosyltransferase 1(FUT1) detection. Tested with WB, IHC-P in Human;Mouse; Rat.

Background: Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.

References

1. "Entrez Gene: FUT1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)". 2. Ball SP, Tongue N, Gibaud A et al. (1992). "The human chromosome 19 linkage group FUT1 (H), FUT2 (SE), LE, LU, PEPD, C3, APOC2, D19S7 and D19S9". Ann. Hum. Genet. 55 (Pt 3): 225-33. 3. Yip SP, Chee KY, Chan PY et al. (2003). "Molecular genetic analysis of para-Bombay phenotypes in Chinese: a novel non-functional FUT1 allele is identified". Vox Sang. 83 (3): 258-62.

NCBI and Uniprot Product Information

• NCBI GI #: 4503805
• NCBI GeneID: 2523
• NCBI Accession #: NP_000139.1
• NCBI GenBank Nucleotide #: NM_000148.3
• UniProt Accession #: P19526; O14505; O14506; O14507
• Molecular Weight: 41,251 Da
• NCBI Official Full Name: galactoside 2-alpha-L-fucosyltransferase 1
• NCBI Official Synonym Full Names: fucosyltransferase 1 (H blood group)
• NCBI Official Symbol: FUT1
• NCBI Official Synonym Symbols: H; HH; HSC
• NCBI Protein Information: galactoside 2-alpha-L-fucosyltransferase 1
• UniProt Protein Name: Galactoside 2-alpha-L-fucosyltransferase 1
• Protein Family: Galactoside 2-alpha-L-fucosyltransferase
• UniProt Gene Name: FUT1
• UniProt Synonym Gene Names: H; HSC
• UniProt Entry Name: FUT1_HUMAN

NCBI Description

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq, Jul 2008]

Uniprot Description

FUT1: Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values. Belongs to the glycosyltransferase 11 family.

Protein type: Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; Membrane protein, integral; Transferase; EC 2.4.1.69; Glycan Metabolism - glycosphingolipid biosynthesis - globo series

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: Golgi apparatus; integral to plasma membrane; membrane

Molecular Function: fucosyltransferase activity; galactoside 2-alpha-L-fucosyltransferase activity

Biological Process: carbohydrate metabolic process; L-fucose catabolic process; protein amino acid glycosylation