PKLR Polyclonal Antibody | anti-PKLR antibody

Anti-PKLR Antibody

Cat. Num. AAA177990

• Gene Names: PKLR; PK1; PKL; PKR; RPK; PKRL
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: PKLR; Polyclonal Antibody; Anti-PKLR Antibody; Pyruvate kinase PKLR; EC 2.7.1.40; KPYR_HUMAN; L-PK; Pk-1; PK1; PKL; Pklg; Pklr; PKR; PKRL; Pyruvate kinase 1; Pyruvate kinase isozymes R/L; Pyruvate kinase liver and blood cell; Pyruvate kinase liver and RBC; Pyruvate kinase liver and red blood cell; Pyruvate kinase liver type; Pyruvate kinase type L; Pyruvate kinase; red cell type; R type/L type pyruvate kinase; R-PK; R-type/L-type pyruvate kinase; Red cell/liver pyruvate kinase; RPK; pyruvate kinase; liver and RBC; anti-PKLR antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 574

• Applicable Applications for anti-PKLR antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PKLR (522-552aa EAIWADDVDRRVQFGIESGKLRGFLRVGDLV), different from the related mouse sequence by one amino acid, and identical to the rat sequence.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti-PKLR Picoband antibody, MBS177990, Western blottingAll lanes: Anti PKLR (MBS177990) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugPredicted bind size: 62KDObserved bind size: 62KD )

Immunohistochemistry (IHC)

(Anti-PKLR Picoband antibody, MBS177990, IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Related Product Information for anti-PKLR antibody

Description: Rabbit IgG polyclonal antibody for Pyruvate kinase PKLR(PKLR) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene. It is mapped to 1q21. The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.

References

1. "Entrez Gene: PKLR pyruvate kinase, liver and RBC". 2. Tani K, Fujii H, Tsutsumi H, Sukegawa J, Toyoshima K, Yoshida MC, Noguchi T, Tanaka T, Miwa S (Apr 1987). "Human liver type pyruvate kinase: cDNA cloning and chromosomal assignment". Biochem Biophys Res Commun 143 (2): 431-8.

NCBI and Uniprot Product Information

• NCBI GI #: 10835121
• NCBI GeneID: 5313
• NCBI Accession #: NP_000289.1
• NCBI GenBank Nucleotide #: NM_000298.5
• UniProt Accession #: P30613; O75758; P11973
• Molecular Weight: 58,494 Da
• NCBI Official Full Name: pyruvate kinase PKLR isoform 1
• NCBI Official Synonym Full Names: pyruvate kinase, liver and RBC
• NCBI Official Symbol: PKLR
• NCBI Official Synonym Symbols: PK1; PKL; PKR; RPK; PKRL
• NCBI Protein Information: pyruvate kinase PKLR
• UniProt Protein Name: Pyruvate kinase PKLR
• Protein Family: Pyruvate kinase
• UniProt Gene Name: PKLR
• UniProt Synonym Gene Names: PK1; PKL
• UniProt Entry Name: KPYR_HUMAN

NCBI Description

The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PKLR: one of three rate-limiting enzymes in glycolysis. It catalyzes the transfer of a phosphate group from phosphoenolpyruvate (PEP) to ADP, yielding one molecule ATP and a pyruvate molecule, which is a central metabolic intermediate that can be used as a building block or oxidized further. There are several mammalian isozymes of pyruvate kinase encoded by different genes. The L type predominates in liver, and the M type in muscle and brain. Two alternatively spliced human isoforms have been described: the R- and L-types.

Protein type: Nucleotide Metabolism - purine; Carbohydrate Metabolism - pyruvate; Kinase, other; EC 2.7.1.40; Carbohydrate Metabolism - glycolysis and gluconeogenesis

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: cytosol

Molecular Function: ATP binding; kinase activity; magnesium ion binding; potassium ion binding; pyruvate kinase activity

Biological Process: ATP biosynthetic process; cellular response to insulin stimulus; pyruvate biosynthetic process; response to ATP; response to cAMP; response to glucose stimulus; response to heat; response to hypoxia; response to lithium ion; response to nutrient

Disease: Adenosine Triphosphate, Elevated, Of Erythrocytes; Pyruvate Kinase Deficiency Of Red Cells