Hsp90 beta Polyclonal Antibody | anti-HSP90AB1 antibody

Anti-Hsp90 beta Antibody

Cat. Num. AAA177979

• Gene Names: HSP90AB1; HSP84; HSPC2; HSPCB; D6S182; HSP90B
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: Hsp90 beta; Polyclonal Antibody; Anti-Hsp90 beta Antibody; Heat shock protein HSP 90-beta; 90 kda heat shock protein beta HSP90 beta; D6S182; FLJ26984; Heat shock 84 kDa; Heat shock 90kD protein 1; beta; Heat shock 90kDa protein 1 beta; Heat shock protein 90kDa alpha (cytosolic) class B member 1; Heat shock protein beta; Heat shock protein HSP 90 beta; HS90B_HUMAN; HSP 84; HSP 90; HSP 90 b; HSP 90b; HSP84; HSP90 BETA; hsp90ab1; HSP90B; HSPC2; HSPCB; heat shock protein 90kDa alpha (cytosolic); class B member 1; anti-HSP90AB1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 724

• Applicable Applications for anti-HSP90AB1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Hsp90 beta Picoband antibody, MBS177979, Western blottingAll lanes: Anti Hsp90 beta (MBS177979) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: SW620 Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugPredicted bind size: 90KDObserved bind size: 90KD )

Immunohistochemistry (IHC)

(Anti- Hsp90 beta Picoband antibody, MBS177979, IHC(P)IHC(P): Mouse Testis Tissue )

Immunohistochemistry (IHC)

(Anti- Hsp90 beta Picoband antibody, MBS177979, IHC(P)IHC(P): Rat Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- Hsp90 beta Picoband antibody, MBS177979, IHC(P)IHC(P): Human Placenta Tissue )

Related Product Information for anti-HSP90AB1 antibody

Description: Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-beta(HSP90AB1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.

References

1. "Entrez Gene: HSP90AB1 Heat shock protein 90kDa alpha (cytosolic), class B member 1". 2. Chen B, Piel WH, Gui L, Bruford E, Monteiro A (Dec 2005). "The HSP90 family of genes in the human genome: insights into their divergence and evolution". Genomics 86 (6): 627-37. 3. Rebbe NF, Hickman WS, Ley TJ, Stafford DW, Hickman S (Sep 1989). "Nucleotide sequence and regulation of a human 90-kDa heat shock protein gene". The Journal of Biological Chemistry 264 (25): 15006-11.

NCBI and Uniprot Product Information

• NCBI GI #: 431822401
• NCBI GeneID: 3326
• NCBI Accession #: NP_001258898.1
• NCBI GenBank Nucleotide #: NM_001271969.1
• UniProt Accession #: P08238; Q5T9W7; Q9NQW0; Q9NTK6; B2R5P0
• Molecular Weight: 83,264 Da
• NCBI Official Full Name: heat shock protein HSP 90-beta isoform a
• NCBI Official Synonym Full Names: heat shock protein 90kDa alpha family class B member 1
• NCBI Official Symbol: HSP90AB1
• NCBI Official Synonym Symbols: HSP84; HSPC2; HSPCB; D6S182; HSP90B
• NCBI Protein Information: heat shock protein HSP 90-beta
• UniProt Protein Name: Heat shock protein HSP 90-beta
• Protein Family: Heat shock protein
• UniProt Gene Name: HSP90AB1
• UniProt Synonym Gene Names: HSP90B; HSPC2; HSPCB; HSP 90; HSP 84; HSP84
• UniProt Entry Name: HS90B_HUMAN

NCBI Description

This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. This gene encodes the constitutive form of the cytosolic 90 kDa heat-shock protein and is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Dec 2012]

Uniprot Description

HSP90B: Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Homodimer. Interacts with p53/TP53. Forms a complex with CDK6 and Hsp90/HSP90AB1. Interacts with UNC45A. Binding to UNC45A involves 2 UNC45A monomers per HSP90AB1 dimer. Interacts with CHORDC1 and DNAJC7. Interacts with FKBP4. Belongs to the heat shock protein 90 family.

Protein type: Heat shock protein; Chaperone

Chromosomal Location of Human Ortholog: 6p12

Cellular Component: apical plasma membrane; basolateral plasma membrane; brush border membrane; cell surface; cytoplasm; cytosol; inclusion body; melanosome; membrane; mitochondrion; nucleoplasm; signalosome

Molecular Function: ATP binding; dATP binding; double-stranded RNA binding; GTP binding; histone deacetylase binding; kinase binding; nitric-oxide synthase regulator activity; protein binding; protein kinase binding; protein kinase regulator activity; sulfonylurea receptor binding; TPR domain binding; unfolded protein binding

Biological Process: negative regulation of neuron apoptosis; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; placenta development; positive regulation of cell size; positive regulation of nitric oxide biosynthetic process; positive regulation of protein binding; positive regulation of protein import into nucleus, translocation; protein folding; protein stabilization; regulation of protein ubiquitination; response to salt stress; response to unfolded protein; virion attachment to host cell surface receptor