Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of HDGF expression in rat liver extract (lane 1) and 22RV1 whole cell lysates (lane 2). HDGF at 37KD was detected using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit HDGF Polyclonal Antibody | anti-HDGF antibody

Anti-HDGF Antibody

Gene Names
HDGF; HMG1L2
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
HDGF; Polyclonal Antibody; Anti-HDGF Antibody; HMG-1L2; HMG1L2; P51858; Hepatoma-derived growth factor; anti-HDGF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
256
Applicable Applications for anti-HDGF antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HDGF (61-97aa KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKA), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of HDGF expression in rat liver extract (lane 1) and 22RV1 whole cell lysates (lane 2). HDGF at 37KD was detected using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of HDGF expression in rat liver extract (lane 1) and 22RV1 whole cell lysates (lane 2). HDGF at 37KD was detected using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(HDGF was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (HDGF was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(HDGF was detected in paraffin-embedded sections of rat liver tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (HDGF was detected in paraffin-embedded sections of rat liver tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(HDGF was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (HDGF was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(HDGF was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (HDGF was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- HDGF Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )
Related Product Information for anti-HDGF antibody
Rabbit IgG polyclonal antibody for Hepatoma-derived growth factor(HDGF) detection.
Background: Hepatoma-derived growth factor (HDGF), also known as high mobility group protein 1-like 2 (HMG-1L2), is a protein that in humans is encoded by the HDGF gene. This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. And this gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.
References
1. "Entrez Gene: HDGF hepatoma-derived growth factor (high-mobility group protein 1-like)".
2. Everett AD, Bushweller J (2003). "Hepatoma derived growth factor is a nuclear targeted mitogen.". Current drug targets. 4 (5): 367-71.
3. Wanschura S, Schoenmakers EF, Huysmans C, Bartnitzke S, Van de Ven WJ, Bullerdiek J (May 1997). "Mapping of the gene encoding the human hepatoma-derived growth factor (HDGF) with homology to the high-mobility group (HMG)-1 protein to Xq25". Genomics. 32 (2): 298-300.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,264 Da
NCBI Official Full Name
hepatoma-derived growth factor isoform b
NCBI Official Synonym Full Names
hepatoma derived growth factor
NCBI Official Symbol
HDGF
NCBI Official Synonym Symbols
HMG1L2
NCBI Protein Information
hepatoma-derived growth factor
UniProt Protein Name
Hepatoma-derived growth factor
UniProt Gene Name
HDGF
UniProt Synonym Gene Names
HMG1L2; HDGF; HMG-1L2

NCBI Description

This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2016]

Uniprot Description

Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor.

Research Articles on HDGF

Similar Products

Product Notes

The HDGF hdgf (Catalog #AAA178633) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-HDGF Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HDGF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the HDGF hdgf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HDGF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.