Grp75 Polyclonal Antibody | anti-Grp75 antibody

Anti-Grp75 Antibody

Cat. Num. AAA177947

• Gene Names: HSPA9; CSA; MOT; MOT2; SAAN; CRP40; EVPLS; GRP75; PBP74; GRP-75; HSPA9B; SIDBA4; MTHSP75; HEL-S-124m
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: Grp75; Polyclonal Antibody; Anti-Grp75 Antibody; Stress-70 protein; 75 kDa glucose regulated protein; 75 kDa glucose-regulated protein; CSA; Glucose Regulated Protein; Grp 75; GRP-75; GRP75; GRP75_HUMAN; Heat shock 70 kDa protein 9; Heat shock 70kD protein 9; heat shock 70kDa protein 9; Heat shock 70kDa protein 9B; Heat shock protein 74 kDa A; Heat shock protein A; Heat shock protein cognate 74; Hsc74; Hsp74; Hsp74a; HSPA9; Hspa9a; HSPA9B; MGC4500; mitochondrial; Mortalin 2; Mortalin; Mortalin perinuclear; Mortalin2; MOT 2; MOT; MOT2; Mthsp70; p66 mortalin; P66 MOT; PBP74; Peptide binding protein 74; Peptide-binding protein 74; Stress 70 protein mitochondrial; Stress 70 protein mitochondrial precursor; Stress-70 protein antibody; heat shock 70kDa protein 9 (mortalin); anti-Grp75 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 679

• Applicable Applications for anti-Grp75 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Grp75 Picoband antibody, MBS177947, Western blottingAll lanes: Anti Grp75 (MBS177947) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Rat Testis Tissue Lysate at 50ugLane 4: Mouse Liver Tissue Lysate at 50ugLane 5: Mouse Thymus Tissue Lysate at 50ugLane 6: Mouse Testis Tissue Lysate at 50ugLane 7: HELA Whole Cell Lysate at 40ugLane 8: MCF-7 Whole Cell Lysate at 40ugLane 9: SW620 Whole Cell Lysate at 40ugLane 10: SMMC Whole Cell Lysate at 40ugPredicted bind size: 74KDObserved bind size: 74KD )

Immunohistochemistry (IHC)

(Anti- Grp75 Picoband antibody, MBS177947,IHC(P)IHC(P): Mouse Kidney Tissue )

Immunohistochemistry (IHC)

(Anti- Grp75 Picoband antibody, MBS177947,IHC(P)IHC(P): Rat Kidney Tissue )

Immunohistochemistry (IHC)

(Anti- Grp75 Picoband antibody, MBS177947,IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Related Product Information for anti-Grp75 antibody

Description: Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

References

1. Chen, T. H.-P., Kambal, A., Krysiak, K., Walshauser, M. A., Raju, G., Tibbitts, J. F., Walter, M. J. Knockdown of Hspa9, a del(5q31.2) gene, results in a decrease in hematopoietic progenitors in mice. Blood 117: 1530-1539, 2011. 2. Gross, M. B. Personal Communication. Baltimore, Md. 9/12/2011. 3. Kaul, S. C., Wadhwa, R., Matsuda, Y., Hensler, P. J., Pereira-Smith, O. M., Komatsu, Y., Mitsui, Y. Mouse and human chromosomal assignments of mortalin, a novel member of the murine hsp70 family of proteins. FEBS Lett. 361: 269-272, 1995.

NCBI and Uniprot Product Information

• NCBI GI #: 24234688
• NCBI GeneID: 3313
• NCBI Accession #: NP_004125.3
• NCBI GenBank Nucleotide #: NM_004134.6
• UniProt Accession #: P38646; P30036; P31932; Q1HB43; Q53H23; Q6GU03; Q9BWB7; Q9UC56; B2RCM1
• Molecular Weight: 73,680 Da
• NCBI Official Full Name: stress-70 protein, mitochondrial
• NCBI Official Synonym Full Names: heat shock protein family A (Hsp70) member 9
• NCBI Official Symbol: HSPA9
• NCBI Official Synonym Symbols: CSA; MOT; MOT2; SAAN; CRP40; EVPLS; GRP75; PBP74; GRP-75; HSPA9B; SIDBA4; MTHSP75; HEL-S-124m
• NCBI Protein Information: stress-70 protein, mitochondrial
• UniProt Protein Name: Stress-70 protein, mitochondrial
• UniProt Gene Name: HSPA9
• UniProt Synonym Gene Names: GRP75; HSPA9B; mt-HSP70; GRP-75; MOT; PBP74
• UniProt Entry Name: GRP75_HUMAN

NCBI Description

This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cognate protein. This protein plays a role in cell proliferation, stress response and maintenance of the mitochondria. A pseudogene of this gene is found on chromosome 2.[provided by RefSeq, May 2010]

Uniprot Description

HSPA9B: Implicated in the control of cell proliferation and cellular aging. May also act as a chaperone. Interacts with FXN. Interacts with HSCB. Component of the MINOS/MitOS complex, that includes IMMT, HSPA9 and CHCHD3 and associates with mitochondrial outer membrane proteins SAMM50, MTX1 and MTX2. Belongs to the heat shock protein 70 family.

Protein type: Nucleolus; Heat shock protein; Chaperone

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: cytoplasm; focal adhesion; mitochondrion; myelin sheath; nucleolus

Molecular Function: ATP binding; fibroblast growth factor binding; heat shock protein binding; protein binding; ubiquitin protein ligase binding; unfolded protein binding

Biological Process: negative regulation of apoptosis; protein export from nucleus; protein folding; response to toxin