Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Kv1.4 Picoband antibody, MBS177914, Western blottingAll lanes: Anti Kv1.4 (MBS177914) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: HT1080 Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugPredicted bind size: 73KDObserved bind size: 73KD )

anti-Human Kv1.4 Polyclonal Antibody | anti-Kv1.4 antibody

Anti-Kv1.4 Antibody

Gene Names
KCNA4; HK1; HBK4; PCN2; HPCN2; HUKII; KCNA8; KV1.4; KCNA4L
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
Kv1.4; Polyclonal Antibody; Anti-Kv1.4 Antibody; Potassium voltage-gated channel subfamily A member 4; Voltage gated K+ channel HuKII; cardiac potassium channel; fetal skeletal muscle potassium channel; HBK 4; HBK4; HK 1; HK1; HPCN 2; HPCN2; HUK II; HUKII; KCNA 4; KCNA 8; KCNA4; KCNA4_HUMAN; KCNA4L; KCNA8; kv1.4; PCN 2; PCN2; potassium channel 2; potassium channel KCNA4; potassium channel protein; Potassium voltage gated channel shaker related subfamily member 4; Potassium voltage gated channel subfamily A member 4; potassium voltage-gated channel shaker-related subfamily member 4-like; rapidly inactivating potassium channel; Shaker related potassium channel Kv1.4; shaker-related potassium channel Kv1.4; type A potassium channel; Voltage gated potassium channel HBK4; Voltage gated potassium channel HK1; Voltage gated potassium channel subunit Kv1.4; Voltage-gated K(+) channel HuKII; voltage-gated potassium channel; Voltage-gated potassium channel HBK4; Voltage-gated potassium channel HK1; voltage-gated potassium channel protein Kv1.4; Voltage-gated potassium channel subunit Kv1.4 antibody; potassium voltage-gated channel; shaker-related subfamily; member 4; anti-Kv1.4 antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
653
Applicable Applications for anti-Kv1.4 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Kv1.4 Picoband antibody, MBS177914, Western blottingAll lanes: Anti Kv1.4 (MBS177914) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: HT1080 Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugPredicted bind size: 73KDObserved bind size: 73KD )

Western Blot (WB) (Anti- Kv1.4 Picoband antibody, MBS177914, Western blottingAll lanes: Anti Kv1.4 (MBS177914) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: HT1080 Whole Cell Lysate at 40ugLane 4: PANC Whole Cell Lysate at 40ugPredicted bind size: 73KDObserved bind size: 73KD )

Immunohistochemistry (IHC)

(Anti- Kv1.4 Picoband antibody, MBS177914, IHC(P)IHC(P): Human Lung Cancer Tissue )

Immunohistochemistry (IHC) (Anti- Kv1.4 Picoband antibody, MBS177914, IHC(P)IHC(P): Human Lung Cancer Tissue )
Related Product Information for anti-Kv1.4 antibody
Description: Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 4(KCNA4) detection. Tested with WB, IHC-P in Human.

Background: Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, is a protein that in humans is encoded by the KCNA4 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It is mapped to 11p14.1. KCNA4 belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential. KCNA4 also contributes to the cardiac transient outward potassium current (Ito1), the main contributing current to the repolarizing phase 1 of the cardiac action potential. This gene has been shown to interact with DLG4, KCNA2 and DLG1.
References
1. "Entrez Gene: KCNA4 potassium voltage-gated channel, shaker-related subfamily, member 4". 2. Gutman GA, Chandy KG, Grissmer S, Lazdunski M, McKinnon D, Pardo LA, Robertson GA, Rudy B, Sanguinetti MC, Stuhmer W, Wang X (Dec 2005). "International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels". Pharmacol Rev 57 (4): 473-508. 3. Philipson LH, Schaefer K, LaMendola J, Bell GI, Steiner DF (Feb 1991)."Sequence of a human fetal skeletal muscle potassium channel cDNA related to RCK4". Nucleic Acids Res 18 (23): 7160.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73,257 Da
NCBI Official Full Name
potassium voltage-gated channel subfamily A member 4
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily A member 4
NCBI Official Symbol
KCNA4
NCBI Official Synonym Symbols
HK1; HBK4; PCN2; HPCN2; HUKII; KCNA8; KV1.4; KCNA4L
NCBI Protein Information
potassium voltage-gated channel subfamily A member 4
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 4
UniProt Gene Name
KCNA4
UniProt Synonym Gene Names
KCNA4L
UniProt Entry Name
KCNA4_HUMAN

NCBI Description

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential.[provided by RefSeq, Mar 2011]

Uniprot Description

Kv1.4: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.4/KCNA4 sub-subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, potassium

Chromosomal Location of Human Ortholog: 11p14

Cellular Component: axon; integral to membrane; integral to plasma membrane; plasma membrane; voltage-gated potassium channel complex

Molecular Function: delayed rectifier potassium channel activity; potassium ion binding; protein binding; voltage-gated potassium channel activity

Biological Process: potassium ion transport; protein homooligomerization

Research Articles on Kv1.4

Similar Products

Product Notes

The Kv1.4 kcna4 (Catalog #AAA177914) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Kv1.4 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Kv1.4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the Kv1.4 kcna4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Kv1.4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.