Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- BMP-4 Picoband antibody, MBS177886, Western blottingAll lanes: Anti BMP-4 (MBS177886) at 0.5ug/mlLane 1: Mouse Lung Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: HEPA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugPredicted bind size: 46KDObserved bind size: 46KD)

anti-Human, Mouse BMP4 Polyclonal Antibody | anti-BMP4 antibody

Anti-BMP4 Antibody

Gene Names
BMP4; ZYME; BMP2B; OFC11; BMP2B1; MCOPS6
Reactivity
Human, Mouse
Applications
Western Blot, ELISA
Purity
Immunogen Affinity Purified
Synonyms
BMP4; Polyclonal Antibody; Anti-BMP4 Antibody; Bone morphogenetic protein 4; BMP 2B; BMP 4; BMP-2B; BMP-4; BMP2B; BMP2B1; BMP4_HUMAN; Bone morphogenetic protein 2B; DVR4; MCOPS6; OFC11; ZYME; bone morphogenetic protein 4; anti-BMP4 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
408
Applicable Applications for anti-BMP4 antibody
Western Blot (WB), ELISA (EIA)
Application Notes
ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND), different from the related mouse and rat sequences by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- BMP-4 Picoband antibody, MBS177886, Western blottingAll lanes: Anti BMP-4 (MBS177886) at 0.5ug/mlLane 1: Mouse Lung Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: HEPA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugPredicted bind size: 46KDObserved bind size: 46KD)

Western Blot (WB) (Anti- BMP-4 Picoband antibody, MBS177886, Western blottingAll lanes: Anti BMP-4 (MBS177886) at 0.5ug/mlLane 1: Mouse Lung Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: HEPA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugPredicted bind size: 46KDObserved bind size: 46KD)
Related Product Information for anti-BMP4 antibody
Description: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 4(BMP4) detection. Tested with WB, ELISA in Human;Mouse.

Background: Bone morphogenetic protein 4 is a protein that in humans is encoded by BMP4 gene. It is found on chromosome 14q22-q23. The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
References
1. Knöchel S, Dillinger K, Köster M, Knöchel W (November 2001). "Structure and expression of Xenopus tropicalis BMP-2 and BMP-4 genes". Mech. Dev. 109 (1): 79-82. 2. Oida S, Iimura T, Maruoka Y, Takeda K, Sasaki S (Nov 1995). "Cloning and sequence of bone morphogenetic protein 4 (BMP-4) from a human placental cDNA library". DNA Seq 5 (5): 273-5. 3. van den Wijngaard A, Weghuis DO, Boersma CJ, van Zoelen EJ, Geurts van Kessel A, Olijve W (Nov 1995). "Fine mapping of the human bone morphogenetic protein-4 gene (BMP4) to chromosome 14q22-q23 by in situ hybridization". Genomics 27 (3): 559-60.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
652
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,555 Da
NCBI Official Full Name
bone morphogenetic protein 4 preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 4
NCBI Official Symbol
BMP4
NCBI Official Synonym Symbols
ZYME; BMP2B; OFC11; BMP2B1; MCOPS6
NCBI Protein Information
bone morphogenetic protein 4
UniProt Protein Name
Bone morphogenetic protein 4
UniProt Gene Name
BMP4
UniProt Synonym Gene Names
BMP2B; DVR4; BMP-4; BMP-2B
UniProt Entry Name
BMP4_HUMAN

NCBI Description

This gene encodes a member of the bone morphogenetic protein (BMP) family of proteins, which is part of the transforming growth factor-beta (TGF-beta) superfamily. Members of the BMP family play an important role in bone and cartilage development. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]

Uniprot Description

BMP4: Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Homodimer; disulfide-linked. Interacts with GREM2. Part of a complex consisting of TWSG1 and CHRD. Interacts with the serine proteases, HTRA1 and HTRA3; the interaction with either inhibits BMP4-mediated signaling. The HTRA protease activity is required for this inhibition. Interacts with SOSTDC1. Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines. Belongs to the TGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 14q22-q23

Cellular Component: cytoplasm; extracellular region; extracellular space; proteinaceous extracellular matrix

Molecular Function: chemoattractant activity; cytokine activity; growth factor activity; heparin binding; protein binding; protein homodimerization activity; transforming growth factor beta receptor binding

Biological Process: activation of MAPKK activity; alveolus development; anatomical structure regression; anterior/posterior axis specification; blood vessel endothelial cell proliferation during sprouting angiogenesis; BMP signaling pathway; branching morphogenesis of a tube; chondrocyte differentiation; cloacal septation; common-partner SMAD protein phosphorylation; dorsoventral neural tube patterning; embryonic cranial skeleton morphogenesis; embryonic digit morphogenesis; embryonic hindlimb morphogenesis; endochondral ossification; erythrocyte differentiation; germ cell development; hemopoietic progenitor cell differentiation; inner ear receptor cell differentiation; intermediate mesodermal cell differentiation; kidney development; lymphoid progenitor cell differentiation; macrophage differentiation; mesodermal cell fate determination; mesonephros development; monocyte differentiation; negative regulation of apoptosis; negative regulation of cell cycle; negative regulation of cell proliferation; negative regulation of chondrocyte differentiation; negative regulation of epithelial cell proliferation; negative regulation of immature T cell proliferation in the thymus; negative regulation of MAP kinase activity; negative regulation of mitosis; negative regulation of myoblast differentiation; negative regulation of oligodendrocyte differentiation; negative regulation of phosphorylation; negative regulation of striated muscle development; negative regulation of T cell differentiation in the thymus; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; neural tube closure; neuron fate commitment; odontogenesis; odontogenesis of dentine-containing teeth; osteoblast differentiation; ovarian follicle development; pituitary gland development; positive chemotaxis; positive regulation of apoptosis; positive regulation of BMP signaling pathway; positive regulation of bone mineralization; positive regulation of cardiac muscle fiber development; positive regulation of collagen biosynthetic process; positive regulation of endothelial cell differentiation; positive regulation of endothelial cell proliferation; positive regulation of epidermal cell differentiation; positive regulation of epithelial cell proliferation; positive regulation of ossification; positive regulation of osteoblast differentiation; positive regulation of protein amino acid phosphorylation; positive regulation of protein binding; positive regulation of smooth muscle cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; post-embryonic development; regulation of cell fate commitment; regulation of odontogenesis of dentine-containing teeth; regulation of protein import into nucleus; regulation of smooth muscle cell differentiation; renal system process; response to estradiol stimulus; response to glucocorticoid stimulus; response to retinoic acid; response to testosterone stimulus; retina development in camera-type eye; smooth muscle development; smoothened signaling pathway; specification of organ position; steroid hormone mediated signaling; telencephalon development; telencephalon regionalization; tongue morphogenesis; ureteric bud branching; ureteric bud development; wound healing

Disease: Microphthalmia, Syndromic 6; Orofacial Cleft 11

Research Articles on BMP4

Similar Products

Product Notes

The BMP4 bmp4 (Catalog #AAA177886) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-BMP4 Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's BMP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). ELISA Concentration: 0.1-0.5ug/ml Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the BMP4 bmp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BMP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.