Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Otoferlin Picoband antibody, MBS177788, Western blottingAll lanes: Anti Otoferlin (MBS177788) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: 293T Whole Cell Lysate at 40ugPredicted bind size: 227KDObserved bind size: 227KD )

Otoferlin Polyclonal Antibody | anti-OTOF antibody

Anti-Otoferlin Antibody

Gene Names
OTOF; AUNB1; DFNB6; DFNB9; NSRD9; FER1L2
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
Otoferlin; Polyclonal Antibody; Anti-Otoferlin Antibody; AUNB1; Deafness; autosomal recessive 9; DFNB6; DFNB9; Fer 1 like protein 2; Fer-1-like protein 2; FER1L2; NSRD9; Otof; OTOF_HUMAN; otoferlin; anti-OTOF antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1997
Applicable Applications for anti-OTOF antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western BlotConcentration: Concentration: 0.1-0.5ug/ml; Tested Species: Human, Rat
Immunohistochemistry (IHC) Paraffin: Concentration: 0.5-1ug/ml; Tested Species: Human, Mouse, Rat; Antigen Retrieval: By Heat

Tested Species: In house tested species with positive reuslts.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested
Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Otoferlin (1831-1863aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Otoferlin Picoband antibody, MBS177788, Western blottingAll lanes: Anti Otoferlin (MBS177788) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: 293T Whole Cell Lysate at 40ugPredicted bind size: 227KDObserved bind size: 227KD )

Western Blot (WB) (Anti- Otoferlin Picoband antibody, MBS177788, Western blottingAll lanes: Anti Otoferlin (MBS177788) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: 293T Whole Cell Lysate at 40ugPredicted bind size: 227KDObserved bind size: 227KD )

Immunohistochemistry (IHC)

(Anti- Otoferlin Picoband antibody, MBS177788,IHC(P)IHC(P): Mouse Brain Tissue )

Immunohistochemistry (IHC) (Anti- Otoferlin Picoband antibody, MBS177788,IHC(P)IHC(P): Mouse Brain Tissue )

Immunohistochemistry (IHC)

(Anti- Otoferlin Picoband antibody, MBS177788,IHC(P)IHC(P): Rat Brain Tissue )

Immunohistochemistry (IHC) (Anti- Otoferlin Picoband antibody, MBS177788,IHC(P)IHC(P): Rat Brain Tissue )

Immunohistochemistry (IHC)

(Anti- Otoferlin Picoband antibody, MBS177788,IHC(P)IHC(P): Human Glioma Tissue )

Immunohistochemistry (IHC) (Anti- Otoferlin Picoband antibody, MBS177788,IHC(P)IHC(P): Human Glioma Tissue )
Related Product Information for anti-OTOF antibody
Description: Rabbit IgG polyclonal antibody for Otoferlin(OTOF) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.
References
1. "Entrez Gene: OTOF otoferlin". 2. Rodriguez-Ballesteros M, Reynoso R, Olarte M, Villamar M, Morera C, Santarelli R, Arslan E, Meda C, Curet C, Volter C, Sainz-Quevedo M, Castorina P, Ambrosetti U, Berrettini S, Frei K, Tedin S, Smith J, Cruz Tapia M, Cavalle L, Gelvez N, Primignani P, Gomez-Rosas E, Martin M, Moreno-Pelayo MA, Tamayo M, Moreno-Barral J, Moreno F, del Castillo I (May 2008). "A multicenter study on the prevalence and spectrum of mutations in the otoferlin gene (OTOF) in subjects with nonsyndromic hearing impairment and auditory neuropathy". Hum Mutat 29(6): 823-31. 3. Yasunaga S, Grati M, Cohen-Salmon M, El-Amraoui A, Mustapha M, Salem N, El-Zir E, Loiselet J, Petit C (Apr 1999). "A mutation in OTOF, encoding otoferlin, a FER-1-like protein, causes DFNB9, a nonsyndromic form of deafness". Nat Genet 21 (4): 363-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
otoferlin isoform e
NCBI Official Synonym Full Names
otoferlin
NCBI Official Symbol
OTOF
NCBI Official Synonym Symbols
AUNB1; DFNB6; DFNB9; NSRD9; FER1L2
NCBI Protein Information
otoferlin
UniProt Protein Name
Otoferlin
Protein Family
UniProt Gene Name
OTOF
UniProt Synonym Gene Names
FER1L2
UniProt Entry Name
OTOF_HUMAN

NCBI Description

Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has 3 C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has 6 C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

OTOF: Key calcium ion sensor involved in the Ca(2+)-triggered synaptic vesicle-plasma membrane fusion and in the control of neurotransmitter release at these output synapses. Interacts in a calcium-dependent manner to the presynaptic SNARE proteins at ribbon synapses of cochlear inner hair cells (IHCs) to trigger exocytosis of neurotransmitter. Also essential to synaptic exocytosis in immature outer hair cells (OHCs). May also play a role within the recycling of endosomes. Defects in OTOF are the cause of deafness autosomal recessive type 9 (DFNB9). DFNB9 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Defects in OTOF are a cause of auditory neuropathy, autosomal recessive, type 1 (AUNB1). A form of sensorineural hearing loss with absent or severely abnormal auditory brainstem response, in the presence of normal cochlear outer hair cell function and normal otoacoustic emissions. Auditory neuropathies result from a lesion in the area including the inner hair cells, connections between the inner hair cells and the cochlear branch of the auditory nerve, the auditory nerve itself and auditory pathways of the brainstem. In some cases AUNB1 phenotype can be temperature sensitive. Belongs to the ferlin family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Vesicle

Chromosomal Location of Human Ortholog: 2p23.1

Cellular Component: apical part of cell; basolateral plasma membrane; cell junction; cytosol; endoplasmic reticulum membrane; integral to membrane; synaptic vesicle membrane

Molecular Function: calcium ion binding; protein complex binding

Biological Process: sensory perception of sound; synaptic vesicle exocytosis

Disease: Deafness, Autosomal Recessive 9

Research Articles on OTOF

Similar Products

Product Notes

The OTOF otof (Catalog #AAA177788) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Otoferlin Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Otoferlin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western BlotConcentration: Concentration: 0.1-0.5ug/ml; Tested Species: Human, Rat Immunohistochemistry (IHC) Paraffin: Concentration: 0.5-1ug/ml; Tested Species: Human, Mouse, Rat; Antigen Retrieval: By Heat Tested Species: In house tested species with positive reuslts. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the OTOF otof for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Otoferlin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.