Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human B7-H4/B7S1/B7x Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-60 kDa.)

B7-H4/B7S1/B7x Recombinant Protein | B7-H4 recombinant protein

Recombinant Human B7-H4/B7S1/B7x Protein

Gene Names
VTCN1; B7X; B7H4; B7S1; B7-H4; B7h.5; VCTN1; PRO1291
Purity
>95% by SDS-PAGE.
Synonyms
B7-H4/B7S1/B7x; Recombinant Human B7-H4/B7S1/B7x Protein; B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291; VCTN1; B7-H4 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
Sequence Length
166
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human B7-H4/B7S1/B7x Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-60 kDa.)

SDS-Page (Recombinant Human B7-H4/B7S1/B7x Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 45-60 kDa.)
Related Product Information for B7-H4 recombinant protein
Description: Recombinant Human B7-H4/B7S1/B7x Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe29-Ala258) of human B7-H4/B7S1/B7x (Accession #NP_078902.2) fused with a 6xHis tag at the C-terminus.

Background: B7 homolog 4 (B7-H4, VTCN1) is a member of the B7 family of cell surface ligands that regulate T cell activation and immune responses.B7-H4 is expressed on the surface of activated lymphocytes, macrophages, monocytes, dendritic cells, epithelial cells, and bone marrow-derived mesenchymal stem cells. Its binding to activated T cells dampens T cell responses and induces cell cycle arrest in the T cell.The B7-H4 protein is also found in ovarian cancer, breast cancer, renal cell carcinoma, and rheumatoid arthritis patients.Research studies indicate that B7-H4 protein is present on the surface of ovarian tumor cells, and that targeted inhibition of B7-H4 using recombinant antibodies restores T cell activation pathways. These studies suggest some potential therapeutic value in blocking B7-H4 function and restoring T cell function in cancer patients.
Product Categories/Family for B7-H4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
B7-H4
NCBI Official Synonym Full Names
V-set domain containing T cell activation inhibitor 1
NCBI Official Symbol
VTCN1
NCBI Official Synonym Symbols
B7X; B7H4; B7S1; B7-H4; B7h.5; VCTN1; PRO1291
NCBI Protein Information
V-set domain-containing T-cell activation inhibitor 1
UniProt Protein Name
V-set domain-containing T-cell activation inhibitor 1
UniProt Gene Name
VTCN1
UniProt Synonym Gene Names
B7H4
UniProt Entry Name
VTCN1_HUMAN

NCBI Description

This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

VTCN1: Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor- associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation. Belongs to the immunoglobulin superfamily. BTN/MOG family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p13.1

Cellular Component: integral to membrane; external side of plasma membrane

Molecular Function: receptor binding

Biological Process: response to protozoan; immune system process; positive regulation of T cell proliferation; negative regulation of T cell activation

Research Articles on B7-H4

Similar Products

Product Notes

The B7-H4 vtcn1 (Catalog #AAA9141785) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: FGISGRHSIT VTTVASAGNI GEDGILSCTF EPDIKLSDIV IQWLKEGVLG LVHEFKEGKD ELSEQDEMFR GRTAVFADQV IVGNASLRLK NVQLTDAGTY KCYIITSKGK GNANLEYKTG AFSMPEVNVD YNASSETLRC EAPRWFPQPT VVWASQVDQG ANFSEVSNTS FELNSENVTM KVVSVLYNVT INNTYSCMIE NDIAKATGDI KVTESEIKRR SHLQLLNSKA. It is sometimes possible for the material contained within the vial of "B7-H4/B7S1/B7x, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.