Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Mouse Mannose-binding C Monoclonal Antibody | anti-Mbl2 antibody

Anti Mannose-binding protein C mouse monoclonal antibody

Gene Names
Mbl2; MBL; L-MBP; MBL-C; MBP-C
Reactivity
Mouse
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Protein G purified from mice ascites
Synonyms
Mannose-binding C; Monoclonal Antibody; Anti Mannose-binding protein C mouse monoclonal antibody; Mannose-binding protein C;MBP-C;Mannan-binding protein;RA-reactive factor P28A subunit; anti-Mbl2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Mouse
Clonality
Monoclonal
Isotype
IgG2b
Clone Number
21-D-4
Purity/Purification
Protein G purified from mice ascites
Form/Format
Liquid. Supplied as solution form in PBS, pH7.4, containing 0.05% proclin300, 50% glycerol.
Concentration
1mg/ml (varies by lot)
Applicable Applications for anti-Mbl2 antibody
Elisa (EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Elisa: 1:1000~5000
WB: 1:1000~4000
IHC: 1:50~100
Immunogen
ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
Conjugation
Unconjugate
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Use a manual defrost freezer and avoid repeated freeze thaw cycles. Store at 4 degree C for frequent use. Store at -20 to -80 degree C for ~12 months from the date of receipt
Product Categories/Family for anti-Mbl2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,957 Da
NCBI Official Full Name
mannose-binding protein C
NCBI Official Synonym Full Names
mannose-binding lectin (protein C) 2
NCBI Official Symbol
Mbl2
NCBI Official Synonym Symbols
MBL; L-MBP; MBL-C; MBP-C
NCBI Protein Information
mannose-binding protein C; RARF/P28A; mannan-binding protein; mannose binding lectin (C); RA-reactive factor P28A subunit; mannose binding lectin, liver (C)
UniProt Protein Name
Mannose-binding protein C
Protein Family
UniProt Gene Name
Mbl2
UniProt Synonym Gene Names
MBP-C; RARF/P28A
UniProt Entry Name
MBL2_MOUSE

Uniprot Description

MBL2: Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.

Protein type: Secreted, signal peptide; Secreted

Cellular Component: extracellular space; collagen; extracellular region

Molecular Function: mannose binding; protein self-association; protease binding; galactose binding; calcium ion binding; carbohydrate binding; calcium-dependent protein binding; receptor binding

Biological Process: defense response to Gram-positive bacterium; killing by host of symbiont cells; immune system process; positive regulation of phagocytosis; innate immune response; complement activation, lectin pathway; complement activation, classical pathway; negative regulation of viral reproduction

Research Articles on Mbl2

Similar Products

Product Notes

The Mbl2 mbl2 (Catalog #AAA157898) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti Mannose-binding protein C mouse monoclonal antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Mannose-binding C can be used in a range of immunoassay formats including, but not limited to, Elisa (EIA), Western Blot (WB), Immunohistochemistry (IHC). Elisa: 1:1000~5000 WB: 1:1000~4000 IHC: 1:50~100. Researchers should empirically determine the suitability of the Mbl2 mbl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Mannose-binding C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.