Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 (Enpp3) Recombinant Protein | Enpp3 recombinant protein

Recombinant Mouse Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 (Enpp3) , partial

Gene Names
Enpp3; CD203c; AI876438
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 (Enpp3); Recombinant Mouse Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 (Enpp3); partial; Enpp3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
140-509, Partial, provide the Phosphodiesterase region
Sequence
VTEACASSQEPQCPPGFDLPPVILFSMDGFRAEYLQTWSTLLPNINKLKTCGIHSKYMRAMYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVHLNKNFSLSSVEKSNPAWWSGQPIWLTAMYQGLKAACYYWPGSDVAVNGSFPTIYRNYSNSVPYERRITTLLQWLDLPKADRPSFYTIYVEEPDSAGHSSGPVSAGVIKALQSVDNAFGMLMEGLKQRNLHNCVNIIVLADHGMDQTSCDRVEYMTDYFPKINFYMYQGPAPRIRTRNIPQDFFTFNSEEIVRNLSCRKPDQHFKPYLTPDLPKRLHYAKNVRIDKAHLMVDRQWLAFRSKGSSNCGGGTHGYNNEFKSMEAIFLAHGPSFIEKTVIE
Sequence Length
509
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Enpp3 recombinant protein
This protein belongs to a series of ectoenzymes that are involved in hydrolysis of extracellular nucleotides. These ectoenzymes possess ATPase and ATP pyrophosphatase activities and are type II transmembrane proteins. Expression of the related rat mRNA has been found in a subset of immature glial cells and in the alimentary tract. The corresponding rat protein has been detected in the pancreas, small intestine, colon, and liver. The human mRNA is expressed in glioma cells, prostate, and uterus. Expression of the human protein has been detected in uterus, basophils, and mast cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98,662 Da
NCBI Official Full Name
ectonucleotide pyrophosphatase/phosphodiesterase family member 3
NCBI Official Synonym Full Names
ectonucleotide pyrophosphatase/phosphodiesterase 3
NCBI Official Symbol
Enpp3
NCBI Official Synonym Symbols
CD203c; AI876438
NCBI Protein Information
ectonucleotide pyrophosphatase/phosphodiesterase family member 3
UniProt Protein Name
Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
UniProt Gene Name
Enpp3
UniProt Synonym Gene Names
NPPase

Uniprot Description

Cleaves a variety of phosphodiester and phosphosulfate bonds including deoxynucleotides, nucleotide sugars, and NAD.

Research Articles on Enpp3

Similar Products

Product Notes

The Enpp3 enpp3 (Catalog #AAA1476419) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 140-509, Partial, provide the Phosphodiesterase region. The amino acid sequence is listed below: VTEACASSQE PQCPPGFDLP PVILFSMDGF RAEYLQTWST LLPNINKLKT CGIHSKYMRA MYPTKTFPNH YTIVTGLYPE SHGIIDNNMY DVHLNKNFSL SSVEKSNPAW WSGQPIWLTA MYQGLKAACY YWPGSDVAVN GSFPTIYRNY SNSVPYERRI TTLLQWLDLP KADRPSFYTI YVEEPDSAGH SSGPVSAGVI KALQSVDNAF GMLMEGLKQR NLHNCVNIIV LADHGMDQTS CDRVEYMTDY FPKINFYMYQ GPAPRIRTRN IPQDFFTFNS EEIVRNLSCR KPDQHFKPYL TPDLPKRLHY AKNVRIDKAH LMVDRQWLAF RSKGSSNCGG GTHGYNNEFK SMEAIFLAHG PSFIEKTVIE . It is sometimes possible for the material contained within the vial of "Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 (Enpp3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.