Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human ENPP3 Monoclonal Antibody | anti-ENPP3 antibody

ENPP3 (PDNP3, Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 3, Phosphodiesterase I beta, Phosphodiesterase I/Nucleotide Pyrophosphatase 3, CD203c, Alkaline Phosphodiesterase I, Nucleotide Pyrophosphatase) (AP)

Gene Names
ENPP3; B10; NPP3; PDNP3; CD203c; PD-IBETA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ENPP3; Monoclonal Antibody; ENPP3 (PDNP3; Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 3; Phosphodiesterase I beta; Phosphodiesterase I/Nucleotide Pyrophosphatase 3; CD203c; Alkaline Phosphodiesterase I; Nucleotide Pyrophosphatase) (AP); anti-ENPP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G11
Specificity
Recognizes human ENPP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
875
Applicable Applications for anti-ENPP3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa602-700 from human ENPP3 (NP_005012) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged ENPP3 is 0.1ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged ENPP3 is 0.1ng/ml as a capture antibody)
Related Product Information for anti-ENPP3 antibody
The protein encoded by this gene belongs to a series of ectoenzymes that are involved in hydrolysis of extracellular nucleotides. These ectoenzymes possess ATPase and ATP pyrophosphatase activities and are type II transmembrane proteins. Expression of the related rat mRNA has been found in a subset of immature glial cells and in the alimentary tract. The corresponding rat protein has been detected in the pancreas, small intestine, colon, and liver. The human mRNA is expressed in glioma cells, prostate, and uterus. Expression of the human protein has been detected in uterus, basophils, and mast cells. [provided by RefSeq].
Product Categories/Family for anti-ENPP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ectonucleotide pyrophosphatase/phosphodiesterase family member 3
NCBI Official Synonym Full Names
ectonucleotide pyrophosphatase/phosphodiesterase 3
NCBI Official Symbol
ENPP3
NCBI Official Synonym Symbols
B10; NPP3; PDNP3; CD203c; PD-IBETA
NCBI Protein Information
ectonucleotide pyrophosphatase/phosphodiesterase family member 3
UniProt Protein Name
Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
UniProt Gene Name
ENPP3
UniProt Synonym Gene Names
PDNP3; E-NPP 3; PD-Ibeta; NPPase
UniProt Entry Name
ENPP3_HUMAN

NCBI Description

The protein encoded by this gene belongs to a series of ectoenzymes that are involved in hydrolysis of extracellular nucleotides. These ectoenzymes possess ATPase and ATP pyrophosphatase activities and are type II transmembrane proteins. Expression of the related rat mRNA has been found in a subset of immature glial cells and in the alimentary tract. The corresponding rat protein has been detected in the pancreas, small intestine, colon, and liver. The human mRNA is expressed in glioma cells, prostate, and uterus. Expression of the human protein has been detected in uterus, basophils, and mast cells. Two transcript variants, one protein coding and the other non-protein coding, have been found for this gene. [provided by RefSeq, Oct 2015]

Uniprot Description

ENPP3: Cleaves a variety of phosphodiester and phosphosulfate bonds including deoxynucleotides, nucleotide sugars, and NAD. Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.

Protein type: Cofactor and Vitamin Metabolism - pantothenate and CoA biosynthesis; Nucleotide Metabolism - purine; EC 3.1.4.1; Phosphodiesterase; Motility/polarity/chemotaxis; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; Cofactor and Vitamin Metabolism - riboflavin; Carbohydrate Metabolism - starch and sucrose; Membrane protein, integral; EC 3.6.1.9

Chromosomal Location of Human Ortholog: 6q22

Cellular Component: perinuclear region of cytoplasm; integral to plasma membrane

Molecular Function: nucleotide diphosphatase activity; phosphodiesterase I activity; nucleic acid binding; metal ion binding; nucleoside-triphosphate diphosphatase activity; scavenger receptor activity; polysaccharide binding

Biological Process: receptor-mediated endocytosis; nucleoside triphosphate catabolic process; immune response; phosphate metabolic process; inorganic diphosphate transport

Research Articles on ENPP3

Similar Products

Product Notes

The ENPP3 enpp3 (Catalog #AAA6131130) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ENPP3 (PDNP3, Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 3, Phosphodiesterase I beta, Phosphodiesterase I/Nucleotide Pyrophosphatase 3, CD203c, Alkaline Phosphodiesterase I, Nucleotide Pyrophosphatase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENPP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ENPP3 enpp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENPP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.