Kallikrein-7 (Klk7) Recombinant Protein | Klk7 recombinant protein

Recombinant Mouse Kallikrein-7 (Klk7)

Cat. Num. AAA1469156

• Gene Names: Klk7; SCCE; Prss6
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Kallikrein-7 (Klk7); Recombinant Mouse Kallikrein-7 (Klk7); Klk7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 26-249, full length protein
• Sequence: IIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMGQYQVQLGSDKIGDQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMKTHR
• Sequence Length: 224

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Klk7 recombinant protein

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded enzyme is thought to be involved in the proteolysis of intercellular cohesive structures preceding desquamation, which is the shedding of the outermost layer of the epidermis. Alternative splicing of this gene results in two transcript variants encoding the same protein.

NCBI and Uniprot Product Information

• NCBI GI #: 18777665
• NCBI GeneID: 23993
• NCBI Accession #: NP_036002.1
• NCBI GenBank Nucleotide #: NM_011872.3
• UniProt Accession #: Q91VE3; Q9R048
• Molecular Weight: 27,257 Da
• NCBI Official Full Name: kallikrein-7 preproprotein
• NCBI Official Synonym Full Names: kallikrein related-peptidase 7 (chymotryptic, stratum corneum)
• NCBI Official Symbol: Klk7
• NCBI Official Synonym Symbols: SCCE; Prss6
• NCBI Protein Information: kallikrein-7
• UniProt Protein Name: Kallikrein-7
• Protein Family: Kallikrein
• UniProt Gene Name: Klk7
• UniProt Synonym Gene Names: Prss6; Scce

NCBI Description

This gene encodes a member of the kallikrein subfamily of serine proteases that are involved in diverse physiological functions such as skin desquamation, tooth enamel formation, seminal liquefaction, synaptic neural plasticity and brain function. The encoded preproprotein undergoes proteolytic cleavage of the activation peptide to generate the functional enzyme. This gene is located in a cluster of several related kallikrein genes on chromosome 7. [provided by RefSeq, May 2016]

Uniprot Description

May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-|-Gln-15' and insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.