Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EGF-containing fibulin-like extracellular matrix protein 2 (Efemp2) Recombinant Protein | Efemp2 recombinant protein

Recombinant Mouse EGF-containing fibulin-like extracellular matrix protein 2 (Efemp2)

Gene Names
Efemp2; MBP1; Fbln4; 0610011K11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
EGF-containing fibulin-like extracellular matrix protein 2 (Efemp2); Recombinant Mouse EGF-containing fibulin-like extracellular matrix protein 2 (Efemp2); Efemp2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-443, full length protein
Sequence
SPQDPEEPDSYTECTDGYEWDADSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQQPNPCPQGYEPDEQESCVDVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCNQGYELHRDGFSCSDIDECGYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQPSSIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRSGNTQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF
Sequence Length
418
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Efemp2 recombinant protein
A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fate during development. This protein contains four EGF2 domains and six calcium-binding EGF2 domains. This gene is necessary for elastic fiber formation and connective tissue development. Defects in this gene are cause of an autosomal recessive cutis laxa syndrome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,425 Da
NCBI Official Full Name
EGF-containing fibulin-like extracellular matrix protein 2 isoform 1
NCBI Official Synonym Full Names
epidermal growth factor-containing fibulin-like extracellular matrix protein 2
NCBI Official Symbol
Efemp2
NCBI Official Synonym Symbols
MBP1; Fbln4; 0610011K11Rik
NCBI Protein Information
EGF-containing fibulin-like extracellular matrix protein 2
UniProt Protein Name
EGF-containing fibulin-like extracellular matrix protein 2
UniProt Gene Name
Efemp2
UniProt Synonym Gene Names
Fbln4; Mbp1; FIBL-4

Research Articles on Efemp2

Similar Products

Product Notes

The Efemp2 efemp2 (Catalog #AAA1450800) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-443, full length protein. The amino acid sequence is listed below: SPQDPEEPDS YTECTDGYEW DADSQHCRDV NECLTIPEAC KGEMKCINHY GGYLCLPRSA AVISDLHGEG PPPPAAHAQQ PNPCPQGYEP DEQESCVDVD ECTQALHDCR PSQDCHNLPG SYQCTCPDGY RKIGPECVDI DECRYRYCQH RCVNLPGSFR CQCEPGFQLG PNNRSCVDVN ECDMGAPCEQ RCFNSYGTFL CRCNQGYELH RDGFSCSDID ECGYSSYLCQ YRCVNEPGRF SCHCPQGYQL LATRLCQDID ECETGAHQCS EAQTCVNFHG GYRCVDTNRC VEPYVQVSDN RCLCPASNPL CREQPSSIVH RYMSITSERS VPADVFQIQA TSVYPGAYNA FQIRSGNTQG DFYIRQINNV SAMLVLARPV TGPREYVLDL EMVTMNSLMS YRASSVLRLT VFVGAYTF. It is sometimes possible for the material contained within the vial of "EGF-containing fibulin-like extracellular matrix protein 2 (Efemp2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.