NF-kappa-B inhibitor-interacting Ras-like protein 1 (Nkiras1) Recombinant Protein | Nkiras1 recombinant protein
Recombinant Mouse NF-kappa-B inhibitor-interacting Ras-like protein 1 (Nkiras1)
Gene Names
Nkiras1; KBRAS1; kappaB-Ras1; 2400004O09Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NF-kappa-B inhibitor-interacting Ras-like protein 1 (Nkiras1); Recombinant Mouse NF-kappa-B inhibitor-interacting Ras-like protein 1 (Nkiras1); Nkiras1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-192, full length protein
Sequence
MGKGCKVVICGLLSVGKTAILEQLLYGNHTIGMEDCETLEDVYMASVETDRGVKEQLHLYDTRGLQKGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKLDLSEQRQVDADVAQQWARSEKVKLWEVTVTDRRTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNPEN
Sequence Length
192
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,662 Da
NCBI Official Full Name
NF-kappa-B inhibitor-interacting Ras-like protein 1 isoform 2
NCBI Official Synonym Full Names
NFKB inhibitor interacting Ras-like protein 1
NCBI Official Symbol
Nkiras1
NCBI Official Synonym Symbols
KBRAS1; kappaB-Ras1; 2400004O09Rik
NCBI Protein Information
NF-kappa-B inhibitor-interacting Ras-like protein 1
UniProt Protein Name
NF-kappa-B inhibitor-interacting Ras-like protein 1
Protein Family
UniProt Gene Name
Nkiras1
UniProt Synonym Gene Names
Kappa B-Ras protein 1; KappaB-Ras1
Uniprot Description
Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB ().
Similar Products
Product Notes
The Nkiras1 nkiras1 (Catalog #AAA1450152) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-192, full length protein. The amino acid sequence is listed below: MGKGCKVVIC GLLSVGKTAI LEQLLYGNHT IGMEDCETLE DVYMASVETD RGVKEQLHLY DTRGLQKGVE LPKHYFSFAD GFVLVYSVNN LESFQRVELL KKEIDKFKDK KEVAIVVLGN KLDLSEQRQV DADVAQQWAR SEKVKLWEVT VTDRRTLIEP FTLLASKLSQ PQSKSSFPLP GRKNKGNSNP EN. It is sometimes possible for the material contained within the vial of "NF-kappa-B inhibitor-interacting Ras-like protein 1 (Nkiras1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
