DEAD-box ATP-dependent RNA helicase 2 (Os01g0639100, LOC_Os01g45190) Recombinant Protein | Os01g0639100 recombinant protein

Recombinant Oryza sativa subsp. japonica DEAD-box ATP-dependent RNA helicase 2 (Os01g0639100, LOC_Os01g45190)

Cat. Num. AAA1449924

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DEAD-box ATP-dependent RNA helicase 2 (Os01g0639100; LOC_Os01g45190); Recombinant Oryza sativa subsp. japonica DEAD-box ATP-dependent RNA helicase 2 (Os01g0639100; Os01g0639100 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-404, Full length protein
• Sequence: MAAATTSRRGPGAMDDENLTFETSPGVEVISSFDQMGIRDDLLRGIYAYGFEKPSAIQQRAVLPIISGRDVIAQAQSGTGKTSMISLSVCQIVDTAVREVQALILSPTRELAAQTERVMLAIGDFINIQVHACIGGKSIGEDIRKLEHGVHVVSGTPGRVCDMIKRRTLRTRAIKLLILDEADEMLGRGFKDQIYDVYRYLPPELQVCLISATLPHEILEMTSKFMTDPVRILVKRDELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTERMRSNNFTVSAMHGDMPQKERDAIMGEFRSGATRVLITTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKKEDIRILRDIEQYYSTQIDEMPMNVADLI
• Sequence Length: 404

• Species: Oryza sativa subsp. japonica (Rice)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 1002234236
• NCBI GeneID: 4326580
• NCBI Accession #: XP_015621327.1
• NCBI GenBank Nucleotide #: XM_015765841.1
• UniProt Accession #: Q5VNM3; B7EMG9
• Molecular Weight: 45,599 Da
• NCBI Official Full Name: DEAD-box ATP-dependent RNA helicase 2
• NCBI Official Symbol: LOC4326580
• NCBI Protein Information: DEAD-box ATP-dependent RNA helicase 2
• UniProt Protein Name: Eukaryotic initiation factor 4A-III homolog A
• Protein Family: DEAD-box ATP-dependent RNA helicase
• UniProt Gene Name: EIF4A3A
• UniProt Synonym Gene Names: OsRH2

Uniprot Description

ATP-dependent RNA helicase. Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Its RNA-dependent ATPase and RNA-helicase activities are induced by MLN51/CASC3, but abolished in presence of the MAGO-Y14 heterodimer, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The inhibition of ATPase activity by the MAGO-Y14 heterodimer increases the RNA-binding affinity of the EJC (). EJC core proteins play essential roles in rice development, growth and reproduction. Regulates the splicing of UDT1 (UNDEVELOPED TAPETUM 1) pre-mRNA transcript. UDT1 is a key regulator in stamen development (PubMed:27071313).