Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CSDA on HeLa cell. [antibody concentration 10 ug/ml])

Mouse CSDA Monoclonal Antibody | anti-CSDA antibody

CSDA (Cold Shock Domain Protein A, CSDA1, DBPA, ZONAB) (PE)

Gene Names
YBX3; CSDA; DBPA; CSDA1; ZONAB
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CSDA; Monoclonal Antibody; CSDA (Cold Shock Domain Protein A; CSDA1; DBPA; ZONAB) (PE); Cold Shock Domain Protein A; ZONAB; anti-CSDA antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H5
Specificity
Recognizes CSDA.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CSDA antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CSDA (NP_003642, 241aa-330aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CSDA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CSDA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CSDA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CSDA on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(CSDA monoclonal antibody (M06), clone 1H5 Western Blot analysis of CSDA expression in HeLa (Cat # L013V1).)

Western Blot (WB) (CSDA monoclonal antibody (M06), clone 1H5 Western Blot analysis of CSDA expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged CSDA is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CSDA is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-CSDA antibody
Mouse monoclonal antibody raised against a partial recombinant CSDA.
Product Categories/Family for anti-CSDA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
Cold shock domain protein A
NCBI Official Synonym Full Names
Y-box binding protein 3
NCBI Official Symbol
YBX3
NCBI Official Synonym Symbols
CSDA; DBPA; CSDA1; ZONAB
NCBI Protein Information
Y-box-binding protein 3
UniProt Protein Name
DNA-binding protein A
Protein Family
UniProt Gene Name
CSDA
UniProt Synonym Gene Names
DBPA
UniProt Entry Name
DBPA_HUMAN

Research Articles on CSDA

Similar Products

Product Notes

The CSDA csda (Catalog #AAA6185716) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CSDA can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSDA csda for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSDA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.