Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FK506 Binding Protein 1A Recombinant Protein | FKBP1A recombinant protein

Recombinant Human FK506 Binding Protein 1A

Gene Names
FKBP1A; FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A
Purity
Greater than 99.0% as determined by SDS-PAGE.
Synonyms
FK506 Binding Protein 1A; Recombinant Human FK506 Binding Protein 1A; FKBP1A Human; FK506 Binding Protein 1A Human Recombinant; FKBP12; PPIase; Peptidyl-prolyl cis-trans isomerase; Rotamase; FKBP-12; FKBP1; PKC12; PKCI2; FKBP12C; FKBP1A; PPIase FKBP1A; FK506-binding protein 1A; 12 kDa FKBP; FKBP-1A; FKBP1A recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 99.0% as determined by SDS-PAGE.
Form/Format
The FKBP1A protein solution contains 50mM Hepes pH-8.0, 150mM NaCl, 0.5mM EDTA & 1mM sodium azide.
Sterile Filtered colorless solution.
Sequence
The amino acid sequence of recombinant His-tagged FKBP12 is reported as following:MAHHHHHHVMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE.
Sequence Length
108
Related Product Information for FKBP1A recombinant protein
Description: FKPB1A Human Recombinant fused to N-terminal His-Tag produced in E Coli is a single, non-glycosylated polypeptide chain purified through a Ni2+-affinity chromatography followed by gel filtration.

Introduction: FKBP1A is a 12kDa protein initialy discovered onin immune cells on the basis of its capability to bind and mediate the intracellular effect of the immunosuppressant FK506. FKBP1A is also known to mediate the action of Rapamycin-immunosuppressive agent.FKBP1A is part of the family of immunophilins, which have in common high affinity for immunosuppressant drugs and a peptidyl-prolyl cis-trans isomerase (PPIase).Activity which participates in folding of proline-containing protein. In the absence of immunosuppressive ligands, FKBP1A is involved in intracellular calcium regulation by associating with 3 types of Ca2+ release channel complexes: skeletal ryanodine receptors, cardiac ryanodine receptors and the inositol 1,4,5-triphosphate receptor. FKBP1A also interact with TGF-? type I receptor exerting an inhibitory effect on the TGF-? signaling pathway. FKBP12 plays a role in modulation of ryanodine receptor isoform-1 (ryr-1), a component of the calcium release channel of skeletal muscle sarcoplasmic reticulum. FKBP1A increase the folding of proteins and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Product Categories/Family for FKBP1A recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,951 Da
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP1A isoform a
NCBI Official Synonym Full Names
FK506 binding protein 1A, 12kDa
NCBI Official Symbol
FKBP1A
NCBI Official Synonym Symbols
FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP1A; 12 kDa FK506-binding protein; 12 kDa FKBP; FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 12; FK506-binding protein 1A (12kD); FK506-binding protein, T-cell, 12-kD; FKBP12-Exip3; PPIase FKBP1A; calstabin 1; calstabin-1; immunophilin FKBP12; protein kinase C inhibitor 2; rotamase
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP1A
UniProt Gene Name
FKBP1A
UniProt Synonym Gene Names
FKBP1; FKBP12; PPIase FKBP1A; 12 kDa FKBP; FKBP-12; FKBP-1A
UniProt Entry Name
FKB1A_HUMAN

NCBI Description

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq, Sep 2008]

Uniprot Description

FKBP12: an immunophilin and peptidyl-prolyl cis-trans isomerase that binds to the immunosuppressant drugs FK506 (a.k.a. tacrolimus or Fujimycin) and rapamycin (a.k.a. Sirolimus). The FKBP12/rapamycin complex binds NFAT transcription factors and inhibits the induction of T cell genes including IL-2, IL-3, IL-4, TNF-alpha and GM-CSF. FK506 is used in treating patients after organ transplant and those suffering from autoimmune disorders. The immunosuppressant activity of FKBP12 is not apparently related to its prolyl isomerase activity. The FKBP12/rapamycin complex inhibits the mammalian target of rapamycin (mTOR) pathway by directly binding the mTOR Complex1 (mTORC1). mTORC1 contains Raptor, mLST8, and PRAS40, and interacts with DEPTOR, which inhibits its activity. mTOR, a S/T protein kinase, is a central regulator of cellular growth and metabolism. Its inhibition enhances the dependence on aerobic glycolysis in leukemic cells.

Protein type: EC 5.2.1.8; Isomerase

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; membrane; cytoplasm; nerve terminal; Z disc; cytosol

Molecular Function: signal transducer activity; protein binding; protein homodimerization activity; FK506 binding; enzyme binding; peptidyl-prolyl cis-trans isomerase activity; activin binding; macrolide binding; calcium channel inhibitor activity; Hsp70 protein binding; SMAD binding; transforming growth factor beta receptor binding

Biological Process: heart morphogenesis; protein maturation via protein folding; protein peptidyl-prolyl isomerization; T cell activation; positive regulation of protein binding; protein folding; response to caffeine; T cell proliferation; regulation of protein localization; negative regulation of protein amino acid phosphorylation; muscle contraction; negative regulation of release of sequestered calcium ion into cytosol; transforming growth factor beta receptor signaling pathway; fibril organization and biogenesis; ventricular cardiac muscle morphogenesis; protein refolding; response to iron ion; regulation of immune response; positive regulation of I-kappaB kinase/NF-kappaB cascade; cytokine and chemokine mediated signaling pathway; regulation of activin receptor signaling pathway; SMAD protein complex assembly; negative regulation of protein phosphatase type 2B activity; 'de novo' protein folding; positive regulation of protein ubiquitination; release of sequestered calcium ion into cytosol

Research Articles on FKBP1A

Similar Products

Product Notes

The FKBP1A fkbp1a (Catalog #AAA143368) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: The amino acid sequence of recombinan t His-tagged FKBP12 is reported as following: MAHHHHH HVMGVQ VETISPGDGR TFPKRGQTCV VHYTGMLEDG KKFDSSRDRN KPFKFMLGKQ EVIRGWEEGV AQMSVGQRAK LTISPDYAYG ATGHPGIIPP HATLVFDVEL LKLE.. It is sometimes possible for the material contained within the vial of "FK506 Binding Protein 1A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.