Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Vascular Endothelial Growth Factor receptor-1 D1-3 Active Protein | FLT1 active protein

Recombinant Human Vascular Endothelial Growth Factor receptor-1 D1-3

Gene Names
FLT1; FLT; FLT-1; VEGFR1; VEGFR-1
Purity
Greater than 90.0% as determined by(a)Analysis by RP-HPLC. (b)Analysis by SDS-PAGE.
Synonyms
Vascular Endothelial Growth Factor receptor-1 D1-3; Recombinant Human Vascular Endothelial Growth Factor receptor-1 D1-3; FLT1 D3 Human; Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant; FLT-1; FLT1; Tyrosine-protein kinase receptor FLT; Flt-1; Tyrosine-protein kinase FRT; Fms-like tyrosine kinase 1; VEGFR-1; FLT1 D3; FLT1 active protein
Ordering
For Research Use Only!
Host
Insect Cells
Purity/Purification
Greater than 90.0% as determined by(a)Analysis by RP-HPLC. (b)Analysis by SDS-PAGE.
Form/Format
FLT1 D1-3 was lyophilized from a concentrated (1mg/ml) sterile solution containing no additives.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY
Sequence Length
687
Solubility
It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
The activity of FLT1D1-3 was determined by its ability to abolish the binding of iodinated VEGF to solid surfaces or cell surfaces receptors, and in Far-Western and cross-linking experiments with iodinated VEGF.
Preparation and Storage
Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution FLT1 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for FLT1 active protein
Description: Soluble FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 352 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF.The FLT1 is purified by proprietary chromatographic techniques.

Introduction: Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes, dendritic cells and on trophoblast cells. The flt-1 gene was first described in 1990. The receptor contains seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular splited tyrosine kinase domain. Compared to VEGFR-2 the Flt-1 receptor has a higher affinity for VEGF but a weaker signaling activity. VEGFR-1 thus leads not to proliferation of endothelial cells, but mediates signals for differentiation. Interestingly a naturally occuring soluble variant of VEGFR-1 (sVEGFR-1) was found in HUVE supernatants in 1996, which is generated by alternative splicing of the flt-1 mRNA. The biological functions of sVEGFR-1 still are not clear, but it seems to be an endogenous regulator of angiogenesis, binding VEGF with the same affinity as the full-length receptor.
Product Categories/Family for FLT1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,175 Da
NCBI Official Full Name
vascular endothelial growth factor receptor 1 isoform 2
NCBI Official Synonym Full Names
fms-related tyrosine kinase 1
NCBI Official Symbol
FLT1
NCBI Official Synonym Symbols
FLT; FLT-1; VEGFR1; VEGFR-1
NCBI Protein Information
vascular endothelial growth factor receptor 1; fms-like tyrosine kinase 1; fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor); tyrosine-protein kinase FRT; tyrosine-protein kinase receptor FLT
UniProt Protein Name
Vascular endothelial growth factor receptor 1
UniProt Gene Name
FLT1
UniProt Synonym Gene Names
FLT; FRT; VEGFR1; VEGFR-1; FLT-1; FLT
UniProt Entry Name
VGFR1_HUMAN

NCBI Description

This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.[provided by RefSeq, May 2009]

Uniprot Description

VEGFR1: a receptor tyrosine kinase of the VEGFR family. Receptor for VEGF, VEGFB and PGF. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. Two splice variant isoforms have been described. Isoform SFlt1 may have an inhibitory role in angiogenesis.

Protein type: Membrane protein, integral; EC 2.7.10.1; Kinase, protein; Protein kinase, tyrosine (receptor); Protein kinase, TK; TK group; VEGFR family

Chromosomal Location of Human Ortholog: 13q12

Cellular Component: extracellular space; focal adhesion; integral to plasma membrane; plasma membrane; receptor complex; endosome

Molecular Function: vascular endothelial growth factor receptor activity; identical protein binding; protein binding; growth factor binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: cell migration; peptidyl-tyrosine phosphorylation; protein amino acid autophosphorylation; positive regulation of phosphoinositide 3-kinase activity; positive regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of phosphoinositide 3-kinase cascade; patterning of blood vessels; monocyte chemotaxis; positive regulation of MAP kinase activity; positive regulation of angiogenesis; positive regulation of MAPKKK cascade; positive regulation of cell proliferation; blood vessel morphogenesis; sprouting angiogenesis; embryonic morphogenesis; vascular endothelial growth factor receptor signaling pathway; cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; positive regulation of cell migration

Research Articles on FLT1

Similar Products

Product Notes

The FLT1 flt1 (Catalog #AAA142780) is an Active Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SKLKDPELSL KGTQHIMQAG QTLHLQCRGE AAHKWSLPEM VSKESERLSI TKSACGRNGK QFCSTLTLNT AQANHTGFYS CKYLAVPTSK KKETESAIYI FISDTGRPFV EMYSEIPEII HMTEGRELVI PCRVTSPNIT VTLKKFPLDT LIPDGKRIIW DSRKGFIISN ATYKEIGLLT CEATVNGHLY KTNYLTHRQT NTIIDVQIST PRPVKLLRGH TLVLNCTATT PLNTRVQMTW SYPDEKNKRA SVRRRIDQSN SHANIFYSVL TIDKMQNKDK GLYTCRVRSG PSFKSVNTSV HIYDKAFITV KHRKQQVLET VAGKRSY. It is sometimes possible for the material contained within the vial of "Vascular Endothelial Growth Factor receptor-1 D1-3, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.