Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Protein deltex-1 (Dtx1) Recombinant Protein | Dtx1 recombinant protein

Recombinant Mouse Protein deltex-1 (Dtx1)

Gene Names
Dtx1; Fxit1; mKIAA4160
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein deltex-1 (Dtx1); Recombinant Mouse Protein deltex-1 (Dtx1); Dtx1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-627, Full length protein
Sequence
MSRPGQGVMVPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPIAPAAPPAPPPPPPPLPPGGPPGALVVRPSATFAGAALWAAPATGPTEPAPPPGVPPRSPSAPNGAPTPGQNNLSRPGPQRSTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRAPKPILHPPPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERLVTASGYEGVLRNKSVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKAIYGEKTGTQPPGKMEFHLIPHSLPGFADTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPNNEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASYLDNVLAELTAQGVSEAMAKA
Sequence Length
627
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Dtx1 recombinant protein
Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,173 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase DTX1
NCBI Official Synonym Full Names
deltex 1, E3 ubiquitin ligase
NCBI Official Symbol
Dtx1
NCBI Official Synonym Symbols
Fxit1; mKIAA4160
NCBI Protein Information
E3 ubiquitin-protein ligase DTX1
UniProt Protein Name
E3 ubiquitin-protein ligase DTX1
Protein Family
UniProt Gene Name
Dtx1
UniProt Synonym Gene Names
Deltex1; mDTX1

Uniprot Description

Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Mainly acts as a positive regulator of Notch, but it also acts as a negative regulator, depending on the developmental and cell context. Mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. Involved in neurogenesis, lymphogenesis and myogenesis, and may also be involved in MZB (Marginal zone B) cell differentiation. Promotes B-cell development at the expense of T-cell development, suggesting that it can antagonize NOTCH1. Functions as an ubiquitin ligase protein in vivo, mediating ubiquitination and promoting degradation of MEKK1, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Research Articles on Dtx1

Similar Products

Product Notes

The Dtx1 dtx1 (Catalog #AAA1423862) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-627, Full length protein. The amino acid sequence is listed below: MSRPGQGVMV PVNGLGFPPQ NVARVVVWEW LNEHSRWRPY TATVCHHIEN VLKEDARGSV VLGQVDAQLV PYIIDLQSMH QFRQDTGTMR PVRRNFYDPS SAPGKGIVWE WENDGGAWTA YDMDICITIQ NAYEKQHPWL DLSSLGFCYL IYFNSMSQMN RQTRRRRRLR RRLDLAYPLT VGSIPKSQSW PVGASSGQPC SCQQCLLVNS TRAASNAILA SQRRKAPIAP AAPPAPPPPP PPLPPGGPPG ALVVRPSATF AGAALWAAPA TGPTEPAPPP GVPPRSPSAP NGAPTPGQNN LSRPGPQRST SVSARASIPP GVPALPVKNL NGTGPVHPAL AGMTGILLCA AGLPVCLTRA PKPILHPPPV SKSDVKPVPG VPGVCRKTKK KHLKKSKNPE DVVRRYMQKV KNPPDEDCTI CMERLVTASG YEGVLRNKSV RPELVGRLGR CGHMYHLLCL VAMYSNGNKD GSLQCPTCKA IYGEKTGTQP PGKMEFHLIP HSLPGFADTQ TIRIVYDIPT GIQGPEHPNP GKKFTARGFP RHCYLPNNEK GRKVLRLLIT AWERRLIFTI GTSNTTGESD TVVWNEIHHK TEFGSNLTGH GYPDASYLDN VLAELTAQGV SEAMAKA. It is sometimes possible for the material contained within the vial of "Protein deltex-1 (Dtx1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual