Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DTX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Rabbit DTX1 Polyclonal Antibody | anti-DTX1 antibody

DTX1 antibody - N-terminal region

Gene Names
DTX1; hDx-1; RNF140
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DTX1; Polyclonal Antibody; DTX1 antibody - N-terminal region; anti-DTX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQ
Sequence Length
620
Applicable Applications for anti-DTX1 antibody
Western Blot (WB)
Homology
Cow: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DTX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DTX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-DTX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-DTX1 antibody
This is a rabbit polyclonal antibody against DTX1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase DTX1
NCBI Official Synonym Full Names
deltex E3 ubiquitin ligase 1
NCBI Official Symbol
DTX1
NCBI Official Synonym Symbols
hDx-1; RNF140
NCBI Protein Information
E3 ubiquitin-protein ligase DTX1
UniProt Protein Name
E3 ubiquitin-protein ligase DTX1
Protein Family
UniProt Gene Name
DTX1
UniProt Synonym Gene Names
Deltex1; hDTX1
UniProt Entry Name
DTX1_HUMAN

NCBI Description

Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity. [provided by RefSeq, Jul 2008]

Uniprot Description

DTX1: Functions as an ubiquitin ligase protein in vivo, mediating ubiquitination and promoting degradation of MEKK1, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity. Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Mainly acts as a positive regulator of Notch, but it also acts as a negative regulator, depending on the developmental and cell context. Mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. Involved in neurogenesis, lymphogenesis and myogenesis, and may also be involved in MZB (Marginal zone B) cell differentiation. Promotes B-cell development at the expense of T- cell development, suggesting that it can antagonize NOTCH1. Belongs to the Deltex family.

Protein type: Ubiquitin conjugating system; EC 6.3.2.-; Ubiquitin ligase; Ligase

Chromosomal Location of Human Ortholog: 12q24.13

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: protein binding; zinc ion binding; ubiquitin protein ligase binding; transcription coactivator activity; Notch binding; SH3 domain binding; ligase activity

Biological Process: transcription from RNA polymerase II promoter; negative regulation of neuron differentiation; Notch signaling pathway; glial cell differentiation; cell surface receptor linked signal transduction; regulation of Notch signaling pathway; transcription, DNA-dependent; protein ubiquitination; negative regulation of T cell differentiation

Research Articles on DTX1

Similar Products

Product Notes

The DTX1 dtx1 (Catalog #AAA3204093) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DTX1 antibody - N-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DTX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DTX1 dtx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRWRPYTATV CHHIENVLKE DARGSVVLGQ VDAQLVPYII DLQSMHQFRQ. It is sometimes possible for the material contained within the vial of "DTX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.