B-type Natriuretic Native Protein | BNP native protein

Human B-type Natriuretic Protein

Cat. Num. AAA142246

• Gene Names: NPPB; BNP
• Purity: Greater than 95.0% as determined by RP-HPLC.
• Synonyms: B-type Natriuretic; Human B-type Natriuretic Protein; BNP Human; B-type Natriuretic Peptide Human; NPPB; Natriuretic Peptide Precursor B; BNP; B-type Natriuretic Peptide; BNP native protein

• Purity/Purification: Greater than 95.0% as determined by RP-HPLC.
• Form/Format: The protein was lyophilized without additives.
• Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
• Sequence Length: 134

• Solubility: It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Preparation and Storage: Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).; ; Please prevent freeze-thaw cycles.

Related Product Information for BNP native protein

Description: B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C₁₄₃H₂₄₄N₅₀O₄₂S ₄.

Introduction: Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.

Product Categories/Family for BNP native protein

Cytokines and Growth Factors; Cytokines; B type Natriuretic Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 4505433
• NCBI GeneID: 4879
• NCBI Accession #: NP_002512.1
• NCBI GenBank Nucleotide #: NM_002521.2
• UniProt Accession #: P16860; Q6FGY0; Q9P2Q7; B0ZBE9
• NCBI Official Full Name: natriuretic peptides B preproprotein
• NCBI Official Synonym Full Names: natriuretic peptide B
• NCBI Official Symbol: NPPB
• NCBI Official Synonym Symbols: BNP
• NCBI Protein Information: natriuretic peptides B; brain type natriuretic peptide; gamma-brain natriuretic peptide; natriuretic peptide precursor B; natriuretic protein
• UniProt Protein Name: Natriuretic peptides B
• UniProt Gene Name: NPPB
• UniProt Synonym Gene Names: BNP(1-32); BNP-32
• UniProt Entry Name: ANFB_HUMAN

NCBI Description

This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq, Nov 2014]

Uniprot Description

NPPB: Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. Belongs to the natriuretic peptide family.

Protein type: Secreted; Hormone; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p36.2

Cellular Component: extracellular space; protein complex; extracellular region

Molecular Function: diuretic hormone activity; hormone activity; receptor binding

Biological Process: cGMP biosynthetic process; negative regulation of angiogenesis; cell surface receptor linked signal transduction; regulation of vasodilation; receptor guanylyl cyclase signaling pathway; regulation of blood pressure; regulation of vascular permeability; negative regulation of cell growth; body fluid secretion; regulation of blood vessel size