Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

BNP protein

BNP, human

Gene Names
NPPB; BNP
Applications
SDS-Page
Purity
>=98%
Synonyms
BNP; human; NPPB; Natriuretic Peptide Precursor B; B-type Natriuretic Peptide; Gamma-brain natriuretic peptide; BNP protein
Ordering
For Research Use Only!
Host
Synthetic
Purity/Purification
>=98%
Form/Format
Lyophilized with no additives
Appearance: Lyophilized protein
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH
Sequence Length
134
Applicable Applications for BNP protein
SDS-PAGE; HPLC
Solubility/Reconstitution Instructions
Centrifuge the vial prior to opening. Reconstitute in sterile H?O to a concentration >= 100 ug/ml. This solution can then be diluted into other aqueous buffers.
Handling
Centrifuge the vial prior to opening.
Preparation and Storage
At -20 degree C
Shelf Life: 12 months

Testing Data

Testing Data
Related Product Information for BNP protein
Background: Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It helps to restore the body's salt and H?O balance and improves heart function. B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
3.464 kDa
NCBI Official Full Name
natriuretic peptides B preproprotein
NCBI Official Synonym Full Names
natriuretic peptide B
NCBI Official Symbol
NPPB
NCBI Official Synonym Symbols
BNP
NCBI Protein Information
natriuretic peptides B
UniProt Protein Name
Natriuretic peptides B
UniProt Gene Name
NPPB
UniProt Synonym Gene Names
BNP(1-32); BNP-32
UniProt Entry Name
ANFB_HUMAN

NCBI Description

This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq, Nov 2014]

Uniprot Description

NPPB: Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. Belongs to the natriuretic peptide family.

Protein type: Hormone; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1p36.2

Cellular Component: extracellular space; protein complex; extracellular region

Molecular Function: diuretic hormone activity; hormone activity; receptor binding

Biological Process: cGMP biosynthetic process; negative regulation of angiogenesis; cell surface receptor linked signal transduction; regulation of vasodilation; receptor guanylyl cyclase signaling pathway; regulation of blood pressure; negative regulation of cell growth; regulation of vascular permeability; body fluid secretion; regulation of blood vessel size

Research Articles on BNP

Similar Products

Product Notes

The BNP nppb (Catalog #AAA844114) is a Protein produced from Synthetic and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BNP can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE; HPLC. Researchers should empirically determine the suitability of the BNP nppb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SPKMVQGSGC FGRKMDRISS SSGLGCKVLR RH-OH. It is sometimes possible for the material contained within the vial of "BNP, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.