Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Gibberellin 20 oxidase 2 (20ox2) Recombinant Protein | 20ox2 recombinant protein

Recombinant Arabidopsis thaliana Gibberellin 20 oxidase 2 (20ox2)

Gene Names
GA20OX2; AT2353; ATGA20OX2; gibberellin 20 oxidase 2; MIO24.5; MIO24_5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gibberellin 20 oxidase 2 (20ox2); Recombinant Arabidopsis thaliana Gibberellin 20 oxidase 2 (20ox2); 20ox2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-378, Full length protein
Sequence
MAILCTTTSPAEKEHEPKQDLEKDQTSPLIFNPSLLNLQSQIPNQFIWPDEEKPSIDIPELNVPFIDLSSQDSTLEAPRVIAEACTKHGFFLVVNHGVSESLIADAHRLMESFFDMPLAGKQKAQRKPGESCGYASSFTGRFSTKLPWKETLSFQFSNDNSGSRTVQDYFSDTLGQEFEQFGKVYQDYCEAMSSLSLKIMELLGLSLGVNRDYFRGFFEENDSIMRLNHYPPCQTPDLTLGTGPHCDPSSLTILHQDHVNGLQVFVDNQWQSIRPNPKAFVVNIGDTFMALSNGIFKSCLHRAVVNRESARKSMAFFLCPKKDKVVKPPSDILEKMKTRKYPDFTWSMFLEFTQKHYRADVNTLDSFSNWVITNNNPI
Sequence Length
378
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,937 Da
NCBI Official Full Name
gibberellin 20 oxidase 2
NCBI Official Symbol
GA20OX2
NCBI Official Synonym Symbols
AT2353; ATGA20OX2; gibberellin 20 oxidase 2; MIO24.5; MIO24_5
NCBI Protein Information
gibberellin 20 oxidase 2
UniProt Protein Name
Gibberellin 20 oxidase 2
UniProt Gene Name
GA20OX2
UniProt Synonym Gene Names
20ox; At2353

NCBI Description

Encodes gibberellin 20-oxidase. Involved in gibberellin biosynthesis. Up-regulated by far red light in elongating petioles. Not regulated by a circadian clock.

Uniprot Description

Key oxidase enzyme in the biosynthesis of gibberellin that catalyzes the conversion of GA12 and GA53 to GA9 and GA20 respectively, via a three-step oxidation at C-20 of the GA skeleton. GA53 is less effectively oxidized than GA12, and GA25 is also formed as a minor product. Involved in the promotion of the floral transition, fertility and silique elongation, but plays only a minor role in elongation of seedling organs. Acts redundantly with GA20OX1.

Research Articles on 20ox2

Similar Products

Product Notes

The 20ox2 ga20ox2 (Catalog #AAA1416730) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-378, Full length protein. The amino acid sequence is listed below: MAILCTTTSP AEKEHEPKQD LEKDQTSPLI FNPSLLNLQS QIPNQFIWPD EEKPSIDIPE LNVPFIDLSS QDSTLEAPRV IAEACTKHGF FLVVNHGVSE SLIADAHRLM ESFFDMPLAG KQKAQRKPGE SCGYASSFTG RFSTKLPWKE TLSFQFSNDN SGSRTVQDYF SDTLGQEFEQ FGKVYQDYCE AMSSLSLKIM ELLGLSLGVN RDYFRGFFEE NDSIMRLNHY PPCQTPDLTL GTGPHCDPSS LTILHQDHVN GLQVFVDNQW QSIRPNPKAF VVNIGDTFMA LSNGIFKSCL HRAVVNRESA RKSMAFFLCP KKDKVVKPPS DILEKMKTRK YPDFTWSMFL EFTQKHYRAD VNTLDSFSNW VITNNNPI. It is sometimes possible for the material contained within the vial of "Gibberellin 20 oxidase 2 (20ox2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.