UPF0361 protein C3orf37 homolog Recombinant Protein | HMCES recombinant protein
Recombinant Pongo abelii UPF0361 protein C3orf37 homolog
Gene Names
HMCES; C3orf37
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0361 protein C3orf37 homolog; Recombinant Pongo abelii UPF0361 protein C3orf37 homolog; HMCES recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-354, Full length protein
Sequence
MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFVKDADSSERIIAPMRWGLVPSWFKESDPSKLQFNTTNCRNDTIMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWGKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGKVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVRKELKASGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKRPYSQ
Sequence Length
354
Species
Pongo abelii (Sumatran orangutan)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,513 Da
NCBI Official Full Name
embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein
NCBI Official Symbol
HMCES
NCBI Official Synonym Symbols
C3orf37
NCBI Protein Information
embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein
UniProt Protein Name
Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein
UniProt Gene Name
HMCES
UniProt Synonym Gene Names
SRAPD1; ES cell-specific 5hmC-binding protein
Uniprot Description
Specifically binds 5-hydroxymethylcytosine (5hmC)-containing DNA in stem cells, suggesting that it acts as a specific reader of 5hmC in stem cells. May act as a peptidase; experimental evidences are however required to confirm this prediction ().
Similar Products
Product Notes
The HMCES hmces (Catalog #AAA1411933) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-354, Full length protein. The amino acid sequence is listed below: MCGRTSCHLP RDVLTRACAY QDRRGQQRLP EWRDPDKYCP SYNKSPQSNS PVLLSRLHFV KDADSSERII APMRWGLVPS WFKESDPSKL QFNTTNCRND TIMEKRSFKV PLGKGRRCVV LADGFYEWQR CQGTNQRQPY FIYFPQIKTE KSGSIGAADS PENWGKVWDN WRLLTMAGIF DCWEPPEGGD VLYSYTIITV DSCKGLSDIH HRMPAILDGE EAVSKWLDFG KVSTQEALKL IHPTENITFH AVSSVVNNSR NNTPECLAPV DLVVRKELKA SGSSQRMLQW LATKSPKKED SKTPQKEESD VPQWSSQFLQ KSPLPTKRGT AGLLEQWLKR EKEEEPVAKR PYSQ. It is sometimes possible for the material contained within the vial of "UPF0361 protein C3orf37 homolog, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
