Protein SSXT (SS18) Recombinant Protein | SS18 recombinant protein
Recombinant Human Protein SSXT (SS18)
Gene Names
SS18; SYT; SSXT
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein SSXT (SS18); Recombinant Human Protein SSXT (SS18); SS18 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-418, Full length protein
Sequence
SVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ
Sequence Length
417
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,216 Da
NCBI Official Full Name
protein SSXT isoform 1
NCBI Official Synonym Full Names
SS18, nBAF chromatin remodeling complex subunit
NCBI Official Symbol
SS18
NCBI Official Synonym Symbols
SYT; SSXT
NCBI Protein Information
protein SSXT
UniProt Protein Name
Protein SSXT
Protein Family
UniProt Gene Name
SS18
UniProt Synonym Gene Names
SSXT; SYT
Uniprot Description
Appears to function synergistically with RBM14 as a transcriptional coactivator. Isoform 1 and isoform 2 function in nuclear receptor coactivation. Isoform 1 and isoform 2 function in general transcriptional coactivation.
Research Articles on SS18
Similar Products
Product Notes
The SS18 ss18 (Catalog #AAA1404675) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-418, Full length protein. The amino acid sequence is listed below: SVAFAAPRQR GKGEITPAAI QKMLDDNNHL IQCIMDSQNK GKTSECSQYQ QMLHTNLVYL ATIADSNQNM QSLLPAPPTQ NMPMGPGGMN QSGPPPPPRS HNMPSDGMVG GGPPAPHMQN QMNGQMPGPN HMPMQGPGPN QLNMTNSSMN MPSSSHGSMG GYNHSVPSSQ SMPVQNQMTM SQGQPMGNYG PRPNMSMQPN QGPMMHQQPP SQQYNMPQGG GQHYQGQQPP MGMMGQVNQG NHMMGQRQIP PYRPPQQGPP QQYSGQEDYY GDQYSHGGQG PPEGMNQQYY PDGHNDYGYQ QPSYPEQGYD RPYEDSSQHY YEGGNSQYGQ QQDAYQGPPP QQGYPPQQQQ YPGQQGYPGQ QQGYGPSQGG PGPQYPNYPQ GQGQQYGGYR PTQPGPPQPP QQRPYGYDQG QYGNYQQ. It is sometimes possible for the material contained within the vial of "Protein SSXT (SS18), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
