Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome P450 1A1 (CYP1A1) Recombinant Protein | CYP1A1 recombinant protein

Recombinant Cat Cytochrome P450 1A1 (CYP1A1), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome P450 1A1 (CYP1A1); Recombinant Cat Cytochrome P450 1A1 (CYP1A1); partial; CYP1A1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
120-469; Partial.
Sequence
ISEGQSMSFSPDSGPVWAARRRLAQNALKSFSIASDPASSSSCYLEDHVSKEAEYLIGKFQELMAKVGHFDPYRYVVVSVANVICAMCFGRRYDHDDQELLSIVNLSNEFGDGTASGNPVDFFPILRYLPNPALDFFKDVNEKFSIFIHKMVKEHYKTFEKGHIRDITDSLIEHCQDKRLDENANIQLSDEKIVNVVSDLFGAGFDTVTTAISWCLMYLVTSPNVQEKIQKELDTVIGRERQPRLSDRLQLPYMEAFILEMFRHTSFVPFTIPHSTTKDTSLSGFYIPKERCVFVNQWQINHDQKLWGDPSEFRPERFLTPDGTINKALSEKVILFGLGKRKCIGETIAR
Sequence Length
469
Species
Felis catus (Cat) (Felis silvestris catus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CYP1A1 recombinant protein
This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme s endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,707 Da
NCBI Official Full Name
cytochrome P450 1A1
NCBI Official Symbol
CYP1A1
NCBI Protein Information
cytochrome P450 1A1
UniProt Protein Name
Cytochrome P450 1A1
Protein Family
UniProt Gene Name
CYP1A1

Uniprot Description

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics ().

Similar Products

Product Notes

The CYP1A1 cyp1a1 (Catalog #AAA1389707) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 120-469; Partial. The amino acid sequence is listed below: ISEGQSMSFS PDSGPVWAAR RRLAQNALKS FSIASDPASS SSCYLEDHVS KEAEYLIGKF QELMAKVGHF DPYRYVVVSV ANVICAMCFG RRYDHDDQEL LSIVNLSNEF GDGTASGNPV DFFPILRYLP NPALDFFKDV NEKFSIFIHK MVKEHYKTFE KGHIRDITDS LIEHCQDKRL DENANIQLSD EKIVNVVSDL FGAGFDTVTT AISWCLMYLV TSPNVQEKIQ KELDTVIGRE RQPRLSDRLQ LPYMEAFILE MFRHTSFVPF TIPHSTTKDT SLSGFYIPKE RCVFVNQWQI NHDQKLWGDP SEFRPERFLT PDGTINKALS EKVILFGLGK RKCIGETIAR . It is sometimes possible for the material contained within the vial of "Cytochrome P450 1A1 (CYP1A1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.