NAD-dependent protein deacetylase sirtuin-2 (sirt2) Recombinant Protein | sirt2 recombinant protein
Recombinant Danio rerio NAD-dependent protein deacetylase sirtuin-2 (sirt2)
Gene Names
sirt2; zgc:55966; zgc:77003; wu:fb57d05
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NAD-dependent protein deacetylase sirtuin-2 (sirt2); Recombinant Danio rerio NAD-dependent protein deacetylase sirtuin-2 (sirt2); sirt2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-379, Full length protein
Sequence
MSEEVSKRVEEEADTPGLEGQSDDSSDEGDASGDTEMDFLRSLFSRTLGLSPGDKVLDELTLDSVARYILSGKCKNIICMVGAGISTSAGIPDFRSPGTGLYANLQKYNLPYPEAIFQIDYFKKHPEPFFALARELYPGQFKPTVYHYFIKMLKDKGLLRRCYSQNIDTLERVAGLEGEDLIEAHGTFHTSHCVSFLCRKEYSMDWMKNQIFSEEIPKCDSCGSLVKPDIVFFGESLPSRFFTSMKADFPQCDLLIIMGTSLQVQPFASLVSRVSNRCPRLLINMEKTGQSEFGMGLFSFGGGMDFDSDKAYRDVAHLSTCDDGCMTLAELLGWKKELEEMVKREHALIDSKDAKKTDKEASQSSKSAVAEAEKTDKTE
Sequence Length
379
Species
Zebrafish
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,315 Da
NCBI Official Full Name
NAD-dependent protein deacetylase sirtuin-2
NCBI Official Synonym Full Names
sirtuin 2 (silent mating type information regulation 2, homolog) 2 (S. cerevisiae)
NCBI Official Symbol
sirt2
NCBI Official Synonym Symbols
zgc:55966; zgc:77003; wu:fb57d05
NCBI Protein Information
NAD-dependent protein deacetylase sirtuin-2
UniProt Protein Name
NAD-dependent protein deacetylase sirtuin-2
Protein Family
UniProt Gene Name
sirt2
Uniprot Description
NAD-dependent protein deacetylase, which deacetylates internal lysines on histone and alpha-tubulin as well as many other proteins such as key transcription factors (). Participates in the modulation of multiple and diverse biological processes such as cell cycle control, genomic integrity, microtubule dynamics, cell differentiation, metabolic networks, and autophagy. Plays a major role in the control of cell cycle progression and genomic stability. Deacetylates histone H4 at 'Lys-16' (H4K16ac) at the VEGFA promoter. Thereby contributes to regulate expression of vegfa, a key regulator of angiogenesis (PubMed:24940000).
Similar Products
Product Notes
The sirt2 sirt2 (Catalog #AAA1388764) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-379, Full length protein. The amino acid sequence is listed below: MSEEVSKRVE EEADTPGLEG QSDDSSDEGD ASGDTEMDFL RSLFSRTLGL SPGDKVLDEL TLDSVARYIL SGKCKNIICM VGAGISTSAG IPDFRSPGTG LYANLQKYNL PYPEAIFQID YFKKHPEPFF ALARELYPGQ FKPTVYHYFI KMLKDKGLLR RCYSQNIDTL ERVAGLEGED LIEAHGTFHT SHCVSFLCRK EYSMDWMKNQ IFSEEIPKCD SCGSLVKPDI VFFGESLPSR FFTSMKADFP QCDLLIIMGT SLQVQPFASL VSRVSNRCPR LLINMEKTGQ SEFGMGLFSF GGGMDFDSDK AYRDVAHLST CDDGCMTLAE LLGWKKELEE MVKREHALID SKDAKKTDKE ASQSSKSAVA EAEKTDKTE. It is sometimes possible for the material contained within the vial of "NAD-dependent protein deacetylase sirtuin-2 (sirt2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
