Cytoplasmic tRNA 2-thiolation protein 2 (CTU2) Recombinant Protein | CTU2 recombinant protein
Recombinant Human Cytoplasmic tRNA 2-thiolation protein 2 (CTU2)
Gene Names
CTU2; NCS2; UPF0432; C16orf84
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytoplasmic tRNA 2-thiolation protein 2 (CTU2); Recombinant Human Cytoplasmic tRNA 2-thiolation protein 2 (CTU2); CTU2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-515, Full length protein
Sequence
CQVGEDYGEPAPEEPPPAPRPSREQKCVKCKEAQPVVVIRAGDAFCRDCFKAFYVHKFRAMLGKNRLIFPGEKVLLAWSGGPSSSSMVWQVLEGLSQDSAKRLRFVAGVIFVDEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQHVLGAGGGPGPTQGEEQPPQPPLDPQNLARPPAPAQTEALSQLFCSVRTLTAKEELLQTLRTHLILHMARAHGYSKVMTGDSCTRLAIKLMTNLALGRGAFLAWDTGFSDERHGDVVVVRPMRDHTLKEVAFYNRLFSVPSVFTPAVDTKAPEKASIHRLMEAFILRLQTQFPSTVSTVYRTSEKLVKGPRDGPAAGDSGPRCLLCMCALDVDAADSATAFGAQTSSRLSQMQSPIPLTETRTPPGPCCSPGVGWAQRCGQGACRREDPQACIEEQLCYSCRVNMKDLPSLDPLPPYILAEAQLRTQRAWGLQEIRDCLIEDSDDEAGQS
Sequence Length
514
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,467 Da
NCBI Official Full Name
cytoplasmic tRNA 2-thiolation protein 2 isoform 1
NCBI Official Synonym Full Names
cytosolic thiouridylase subunit 2
NCBI Official Symbol
CTU2
NCBI Official Synonym Symbols
NCS2; UPF0432; C16orf84
NCBI Protein Information
cytoplasmic tRNA 2-thiolation protein 2
UniProt Protein Name
Cytoplasmic tRNA 2-thiolation protein 2
UniProt Gene Name
CTU2
NCBI Description
This gene encodes a protein which is involved in the post-transcriptional modification of transfer RNAs (tRNAs). The encoded protein plays a role in thiolation of uridine residue present at the wobble position in a subset of tRNAs, resulting in enhanced codon reading accuracy. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
Uniprot Description
Plays a central role in 2-thiolation of mcm5S2U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with CTU1/ATPBD3 that ligates sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.
Research Articles on CTU2
Similar Products
Product Notes
The CTU2 ctu2 (Catalog #AAA1358134) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-515, Full length protein. The amino acid sequence is listed below: CQVGEDYGEP APEEPPPAPR PSREQKCVKC KEAQPVVVIR AGDAFCRDCF KAFYVHKFRA MLGKNRLIFP GEKVLLAWSG GPSSSSMVWQ VLEGLSQDSA KRLRFVAGVI FVDEGAACGQ SLEERSKTLA EVKPILQATG FPWHVVALEE VFSLPPSVLW CSAQELVGSE GAYKAAVDSF LQQQHVLGAG GGPGPTQGEE QPPQPPLDPQ NLARPPAPAQ TEALSQLFCS VRTLTAKEEL LQTLRTHLIL HMARAHGYSK VMTGDSCTRL AIKLMTNLAL GRGAFLAWDT GFSDERHGDV VVVRPMRDHT LKEVAFYNRL FSVPSVFTPA VDTKAPEKAS IHRLMEAFIL RLQTQFPSTV STVYRTSEKL VKGPRDGPAA GDSGPRCLLC MCALDVDAAD SATAFGAQTS SRLSQMQSPI PLTETRTPPG PCCSPGVGWA QRCGQGACRR EDPQACIEEQ LCYSCRVNMK DLPSLDPLPP YILAEAQLRT QRAWGLQEIR DCLIEDSDDE AGQS. It is sometimes possible for the material contained within the vial of "Cytoplasmic tRNA 2-thiolation protein 2 (CTU2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
