Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MBD3L2Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MBD3L2 Polyclonal Antibody | anti-MBD3L2 antibody

MBD3L2 Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MBD3L2; Polyclonal Antibody; MBD3L2 Antibody - middle region; anti-MBD3L2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLD
Sequence Length
208
Applicable Applications for anti-MBD3L2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human MBD3L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MBD3L2Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MBD3L2Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MBD3L2 antibody
This is a rabbit polyclonal antibody against MBD3L2. It was validated on Western Blot

Target Description: This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein has been found in germ cell tumors and some somatic tissues.
Product Categories/Family for anti-MBD3L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
methyl-CpG-binding domain protein 3-like 2
NCBI Official Synonym Full Names
methyl-CpG binding domain protein 3 like 2
NCBI Official Symbol
MBD3L2
NCBI Protein Information
methyl-CpG-binding domain protein 3-like 2
UniProt Protein Name
Methyl-CpG-binding domain protein 3-like 2
UniProt Gene Name
MBD3L2
UniProt Synonym Gene Names
MBD3-like protein 2
UniProt Entry Name
MB3L2_HUMAN

NCBI Description

This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein has been found in germ cell tumors and some somatic tissues. [provided by RefSeq, Jul 2008]

Uniprot Description

Tissue specificity: Detected at low levels in several somatic tissues. Highly expressed in the ovarian teratocarcinoma cell line PA-1. Ref.1

Miscellaneous: The MBD3L proteins are encoded by strongly repeated regions of the 19p13 chromosome. The exact number of functional copies is unclear, and some of them may represent pseudogenes.

Sequence similarities: Belongs to the MBD3L family.

Sequence caution: The sequence AAM28154.2 differs from that shown. Reason: Frameshift at position 204.

Research Articles on MBD3L2

Similar Products

Product Notes

The MBD3L2 mbd3l2 (Catalog #AAA3217175) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MBD3L2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MBD3L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MBD3L2 mbd3l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EHLEKPQQLC AYRRLQALQP CSSQGEGSSP LHLESVLSIL APGTAGESLD. It is sometimes possible for the material contained within the vial of "MBD3L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.