Toll-like receptor 7 (TLR7) Recombinant Protein | TLR7 recombinant protein

Recombinant Human Toll-like receptor 7 (TLR7) , partial

Cat. Num. AAA1355373

• Gene Names: TLR7; TLR7-like
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Toll-like receptor 7 (TLR7); Recombinant Human Toll-like receptor 7 (TLR7); partial; TLR7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 861-1049. Partial, provide the complete Cytoplasmic Domain
• Sequence: HLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV

• Species: Human
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for TLR7 recombinant protein

This protein is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung, placenta, and spleen, and lies in close proximity to another family member, TLR8, on chromosome X.

NCBI and Uniprot Product Information

• NCBI GI #: 7706093
• NCBI GeneID: 51284
• NCBI Accession #: NP_057646.1
• NCBI GenBank Nucleotide #: NM_016562.3
• UniProt Accession #: Q9NYK1; Q9NR98; D1CS69
• Molecular Weight: 29.5 kDa
• NCBI Official Full Name: toll-like receptor 7
• NCBI Official Synonym Full Names: toll like receptor 7
• NCBI Official Symbol: TLR7
• NCBI Official Synonym Symbols: TLR7-like
• NCBI Protein Information: toll-like receptor 7
• UniProt Protein Name: Toll-like receptor 7
• Protein Family: Toll-like receptor
• UniProt Gene Name: TLR7

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung, placenta, and spleen, and lies in close proximity to another family member, TLR8, on chromosome X. [provided by RefSeq, Jul 2008]

Uniprot Description

Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response ().