SDS-PAGE
Unsaturated glucuronyl hydrolase Recombinant Protein | ugl recombinant protein
Recombinant Bacillus sp. (strain GL1) Unsaturated glucuronyl hydrolase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Unsaturated glucuronyl hydrolase ; Recombinant Bacillus sp. (strain GL1) Unsaturated glucuronyl hydrolase ; Glycosaminoglycan hydrolase; Glycuronidase; Unsaturated uronic acid hydrolase; ugl recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-377aa; Full Length
Sequence
MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHDIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR
Sequence Length
377
Species
Bacillus sp. (strain GL1)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for ugl recombinant protein
Catalyzes the hydrolysis of oligosaccharides with unsaturated glucuronyl residues at the non-reducing terminal, to a sugar or an amino sugar, and an unsaturated D-glucuronic acid (GlcA), which is nonenzymatically converted immediately to alpha-keto acid.
References
"Crystal structure of unsaturated glucuronyl hydrolase, responsible for the degradation of glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A resolution."
Itoh T., Akao S., Hashimoto W., Mikami B., Murata K.
J. Biol. Chem. 279:31804-31812(2004)
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
58.9 kDa
NCBI Official Full Name
Unsaturated glucuronyl hydrolase
UniProt Protein Name
Unsaturated glucuronyl hydrolase
Protein Family
UniProt Gene Name
ugl
UniProt Synonym Gene Names
UGL
UniProt Entry Name
UGL_BACGL
Uniprot Description
Catalyzes the hydrolysis of oligosaccharides with unsaturated glucuronyl residues at the non-reducing terminal, to a sugar or an amino sugar, and an unsaturated D-glucuronic acid (GlcA), which is nonenzymatically converted immediately to alpha-keto acid.
Similar Products
Product Notes
The ugl ugl (Catalog #AAA1342529) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-377aa; Full Length. The amino acid sequence is listed below: MWQQAIGDAL GITARNLKKF GDRFPHVSDG SNKYVLNDNT DWTDGFWSGI LWLCYEYTGD EQYREGAVRT VASFRERLDR FENLDHHDIG FLYSLSAKAQ WIVEKDESAR KLALDAADVL MRRWRADAGI IQAWGPKGDP ENGGRIIIDC LLNLPLLLWA GEQTGDPEYR RVAEAHALKS RRFLVRGDDS SYHTFYFDPE NGNAIRGGTH QGNTDGSTWT RGQAWGIYGF ALNSRYLGNA DLLETAKRMA RHFLARVPED GVVYWDFEVP QEPSSYRDSS ASAITACGLL EIASQLDESD PERQRFIDAA KTTVTALRDG YAERDDGEAE GFIRRGSYHV RGGISPDDYT IWGDYYYLEA LLRLERGVTG YWYERGR. It is sometimes possible for the material contained within the vial of "Unsaturated glucuronyl hydrolase , Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
