Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein transport protein SEC13 (SEC13) Recombinant Protein | SEC13 recombinant protein

Recombinant Ustilago maydis Protein transport protein SEC13 (SEC13)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein transport protein SEC13 (SEC13); Recombinant Ustilago maydis Protein transport protein SEC13 (SEC13); SEC13 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-364, Full length protein
Sequence
MTTVTSSSAGLSLSAERPKNIETQHEDMVHDAQLDFYGKRLATCSSDRTVKVFDIVNGTPSTTAETLHGHQGPVWQVAWAHPTFGDILASCSYDGKVVIWKDNGAGASIGASAPYGSQSAYGAPTSSAGGWTKIKEHTLHTASVNSISWAPHELGSILACASSDGNVSVLTFNNDGTWAVDLVAAHPVGCNAVSWAPAVVPGSLISAQSVGANAGAASNGEAKLVKRFASAGCDNTVKIWEFSQEANRFVEVEALQGHSDWVRDVAFAPNVGLPRSYLATASQDRTVLIWTQDSPTAAWSKTALNPISASAAAGAGSNKFPDTVWRVSWSVSGNVLAVSCGDGKITLWKENLKGAWECVSEMDS
Sequence Length
364
Species
Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,168 Da
NCBI Official Full Name
putative protein transport protein
NCBI Official Symbol
UMAG_02245
NCBI Protein Information
putative protein transport protein
UniProt Protein Name
Protein transport protein SEC13
Protein Family
UniProt Gene Name
SEC13

Uniprot Description

Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. It also functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. SEC13 is required for efficient mRNA export from the nucleus to the cytoplasm and for correct nuclear pore biogenesis and distribution ().

Similar Products

Product Notes

The SEC13 sec13 (Catalog #AAA1335913) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-364, Full length protein. The amino acid sequence is listed below: MTTVTSSSAG LSLSAERPKN IETQHEDMVH DAQLDFYGKR LATCSSDRTV KVFDIVNGTP STTAETLHGH QGPVWQVAWA HPTFGDILAS CSYDGKVVIW KDNGAGASIG ASAPYGSQSA YGAPTSSAGG WTKIKEHTLH TASVNSISWA PHELGSILAC ASSDGNVSVL TFNNDGTWAV DLVAAHPVGC NAVSWAPAVV PGSLISAQSV GANAGAASNG EAKLVKRFAS AGCDNTVKIW EFSQEANRFV EVEALQGHSD WVRDVAFAPN VGLPRSYLAT ASQDRTVLIW TQDSPTAAWS KTALNPISAS AAAGAGSNKF PDTVWRVSWS VSGNVLAVSC GDGKITLWKE NLKGAWECVS EMDS. It is sometimes possible for the material contained within the vial of "Protein transport protein SEC13 (SEC13), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.