3-ketoacyl-CoA thiolase 2, peroxisomal (PED1) Recombinant Protein | PED1 recombinant protein
Recombinant Arabidopsis thaliana 3-ketoacyl-CoA thiolase 2, peroxisomal (PED1)
Gene Names
PKT3; 3-KETOACYL-COA THIOLASE 2; KAT2; PED1; peroxisomal 3-ketoacyl-CoA thiolase 3; PEROXISOME DEFECTIVE 1; potassium channel in Arabidopsis thaliana 2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-ketoacyl-CoA thiolase 2; peroxisomal (PED1); Recombinant Arabidopsis thaliana 3-ketoacyl-CoA thiolase 2; PED1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-462, Full length protein
Sequence
LAGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPVKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR
Sequence Length
428
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,579 Da
NCBI Official Full Name
peroxisomal 3-ketoacyl-CoA thiolase 3
NCBI Official Symbol
PKT3
NCBI Official Synonym Symbols
3-KETOACYL-COA THIOLASE 2; KAT2; PED1; peroxisomal 3-ketoacyl-CoA thiolase 3; PEROXISOME DEFECTIVE 1; potassium channel in Arabidopsis thaliana 2
NCBI Protein Information
peroxisomal 3-ketoacyl-CoA thiolase 3
UniProt Protein Name
3-ketoacyl-CoA thiolase 2, peroxisomal
Protein Family
UniProt Gene Name
PED1
UniProt Synonym Gene Names
KAT2
NCBI Description
Encodes an organellar (peroxisome, glyoxysome) 3-ketoacyl-CoA thiolase, involved in fatty acid b-oxidation during germination and subsequent seedling growth. Mutants have defects in glyoxysomal fatty acid beta-oxidation. EC2.3.1.16 thiolase.
Uniprot Description
Involved in long chain fatty-acid beta-oxidation prior to gluconeogenesis during germination and subsequent seedling growth. Confers sensitivity to 2,4-dichlorophenoxybutiric acid (2,4-DB). Required for local and systemic induction of jasmonic acid (JA) biosynthesis after wounding. Seems to be involved in JA biosynthesis during senescence.
Research Articles on PED1
Similar Products
Product Notes
The PED1 ped1 (Catalog #AAA1316397) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-462, Full length protein. The amino acid sequence is listed below: LAGDSAAYQR TSLYGDDVVI VAAHRTPLCK SKRGNFKDTY PDDLLAPVLR ALIEKTNLNP SEVGDIVVGT VLAPGSQRAS ECRMAAFYAG FPETVAVRTV NRQCSSGLQA VADVAAAIKA GFYDIGIGAG LESMTTNPMA WEGSVNPAVK KFAQAQNCLL PMGVTSENVA QRFGVSRQEQ DQAAVDSHRK AAAATAAGKF KDEIIPVKTK LVDPKTGDEK PITVSVDDGI RPTTTLASLG KLKPVFKKDG TTTAGNSSQV SDGAGAVLLM KRSVAMQKGL PVLGVFRTFA AVGVDPAIMG IGPAVAIPAA VKAAGLELDD IDLFEINEAF ASQFVYCRNK LGLDPEKINV NGGAMAIGHP LGATGARCVA TLLHEMKRRG KDCRFGVVSM CIGTGMGAAA VFERGDGVDE LRNARKVEAQ GLLSKDAR. It is sometimes possible for the material contained within the vial of "3-ketoacyl-CoA thiolase 2, peroxisomal (PED1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
