Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Egl nine homolog 1 (Egln1) Recombinant Protein | Egln1 recombinant protein

Recombinant Mouse Egl nine homolog 1 (Egln1)

Gene Names
Egln1; Phd2; HPH-2; ORF13; SM-20; C1orf12; HIF-PH2; AI503754; Hif-p4h-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Egl nine homolog 1 (Egln1); Recombinant Mouse Egl nine homolog 1 (Egln1); Egln1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-400, full length protein
Sequence
ASDSGGPGVLSASERDRQYCELCGKMENLLRCGRCRSSFYCCKEHQRQDWKKHKLVCQGGEAPRAQPAPAQPRVAPPPGGAPGAARAGGAARRGDSAAASRVPGPEDAAQARSGPGPAEPGSEDPPLSRSPGPERASLCPAGGGPGEALSPGGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGRETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDQITWIEGKEPGCETIGLLMSSMDDLIRHCSGKLGNYRINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELKPNSVSKDV
Sequence Length
399
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Egln1 recombinant protein
This protein catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. HIF is a transcriptional complex that plays a central role in mammalian oxygen homeostasis. This protein functions as a cellular oxygen sensor, and under normal oxygen concentration, modification by prolyl hydroxylation is a key regulatory event that targets HIF subunits for proteasomal destruction via the von Hippel-Lindau ubiquitylation complex. Mutations in this gene are associated with erythrocytosis familial type 3 (ECYT3).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,111 Da
NCBI Official Full Name
egl nine homolog 1
NCBI Official Synonym Full Names
egl-9 family hypoxia-inducible factor 1
NCBI Official Symbol
Egln1
NCBI Official Synonym Symbols
Phd2; HPH-2; ORF13; SM-20; C1orf12; HIF-PH2; AI503754; Hif-p4h-2
NCBI Protein Information
egl nine homolog 1
UniProt Protein Name
Egl nine homolog 1
Protein Family
UniProt Gene Name
Egln1
UniProt Synonym Gene Names
HIF-PH2; HIF-prolyl hydroxylase 2; HPH-2; PHD2

Uniprot Description

Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF1B. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN1 is the most important isozyme under normoxia and, through regulating the stability of HIF1, involved in various hypoxia-influenced processes such as angiogenesis in retinal and cardiac functionality. Target proteins are preferentially recognized via a LXXLAP motif.

Research Articles on Egln1

Similar Products

Product Notes

The Egln1 egln1 (Catalog #AAA1314092) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-400, full length protein. The amino acid sequence is listed below: ASDSGGPGVL SASERDRQYC ELCGKMENLL RCGRCRSSFY CCKEHQRQDW KKHKLVCQGG EAPRAQPAPA QPRVAPPPGG APGAARAGGA ARRGDSAAAS RVPGPEDAAQ ARSGPGPAEP GSEDPPLSRS PGPERASLCP AGGGPGEALS PGGGLRPNGQ TKPLPALKLA LEYIVPCMNK HGICVVDDFL GRETGQQIGD EVRALHDTGK FTDGQLVSQK SDSSKDIRGD QITWIEGKEP GCETIGLLMS SMDDLIRHCS GKLGNYRING RTKAMVACYP GNGTGYVRHV DNPNGDGRCV TCIYYLNKDW DAKVSGGILR IFPEGKAQFA DIEPKFDRLL FFWSDRRNPH EVQPAYATRY AITVWYFDAD ERARAKVKYL TGEKGVRVEL KPNSVSKDV. It is sometimes possible for the material contained within the vial of "Egl nine homolog 1 (Egln1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.