Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chitinase-3-like protein 1 (Chi3l1) Recombinant Protein | Chi3l1 recombinant protein

Recombinant Rat Chitinase-3-like protein 1 (Chi3l1)

Gene Names
Chi3l1; Chil1; GP-39; CGP-39
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chitinase-3-like protein 1 (Chi3l1); Recombinant Rat Chitinase-3-like protein 1 (Chi3l1); Chi3l1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-381, full length protein
Sequence
YKLVCYYTNWSQYREGNGSCFPDALDHSLCTHIIYSFANISNNKLSTSEWNDVTLYGMLNTLKTRNPRLKTLLSVGGWSFGSERFSRIVSNAKSRKTFVQSVAPFLRTYGFDGLDLAWLYPGPKDKQHFTTLIKELKAEFTKEVQPGTEKLLLSAAVSAGKVTLDSGYDVAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFRGQQDTGPDRFSNVDYGVGYMLRLGAPTNKLVMGIPTFGKSFTLASSENQVGAPITGSGLPGRYTKEKGTLAYYEICDFLRGAEVHRILGQQVPFATKGNQWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFCGHNVHFPLTNAIKEALAVA
Sequence Length
362
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Chi3l1 recombinant protein
Chitinases catalyze the hydrolysis of chitin, which is an abundant glycopolymer found in insect exoskeletons and fungal cell walls. The glycoside hydrolase 18 family of chitinases includes eight human family members. This gene encodes a glycoprotein member of the glycosyl hydrolase 18 family. The protein lacks chitinase activity and is secreted by activated macrophages, chondrocytes, neutrophils and synovial cells. The protein is thought to play a role in the process of inflammation and tissue remodeling.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,392 Da
NCBI Official Full Name
chitinase-3-like protein 1 isoform 1
NCBI Official Synonym Full Names
chitinase 3 like 1
NCBI Official Symbol
Chi3l1
NCBI Official Synonym Symbols
Chil1; GP-39; CGP-39
NCBI Protein Information
chitinase-3-like protein 1
UniProt Protein Name
Chitinase-3-like protein 1
Protein Family
UniProt Gene Name
Chi3l1
UniProt Synonym Gene Names
CGP-39; GP-39

NCBI Description

human homolog plays a role in vascular smooth muscle cell migration and adhesion [RGD, Feb 2006]

Uniprot Description

Carbohydrate-binding lectin with a preference for chitin. Has no chitinase activity. May play a role in tissue remodeling and in the capacity of cells to respond to and cope with changes in their environment. Plays a role in T-helper cell type 2 (Th2) inflammatory response and IL-13-induced inflammation, regulating allergen sensitization, inflammatory cell apoptosis, dendritic cell accumulation and M2 macrophage differentiation. Facilitates invasion of pathogenic enteric bacteria into colonic mucosa and lymphoid organs. Mediates activation of AKT1 signaling pathway and subsequent IL8 production in colonic epithelial cells. Regulates antibacterial responses in lung by contributing to macrophage bacterial killing, controlling bacterial dissemination and augmenting host tolerance. Also regulates hyperoxia-induced injury, inflammation and epithelial apoptosis in lung ().

Research Articles on Chi3l1

Similar Products

Product Notes

The Chi3l1 chi3l1 (Catalog #AAA1304513) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-381, full length protein. The amino acid sequence is listed below: YKLVCYYTNW SQYREGNGSC FPDALDHSLC THIIYSFANI SNNKLSTSEW NDVTLYGMLN TLKTRNPRLK TLLSVGGWSF GSERFSRIVS NAKSRKTFVQ SVAPFLRTYG FDGLDLAWLY PGPKDKQHFT TLIKELKAEF TKEVQPGTEK LLLSAAVSAG KVTLDSGYDV AQIAQHLDFI NLMTYDFHGT WRHTTGHHSP LFRGQQDTGP DRFSNVDYGV GYMLRLGAPT NKLVMGIPTF GKSFTLASSE NQVGAPITGS GLPGRYTKEK GTLAYYEICD FLRGAEVHRI LGQQVPFATK GNQWVGYDDP ESVKNKVKYL KNKQLAGAMV WAVDLDDFRG SFCGHNVHFP LTNAIKEALA VA. It is sometimes possible for the material contained within the vial of "Chitinase-3-like protein 1 (Chi3l1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.