Mouse NCOA4 Monoclonal Antibody | anti-NCOA4 antibody

NCOA4 (Nuclear Receptor Coactivator 4, ARA70, DKFZp762E1112, ELE1, PTC3, RFG) (HRP)

Cat. Num. AAA6180884

• Gene Names: NCOA4; RFG; ELE1; PTC3; ARA70
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: NCOA4; Monoclonal Antibody; NCOA4 (Nuclear Receptor Coactivator 4; ARA70; DKFZp762E1112; ELE1; PTC3; RFG) (HRP); Nuclear Receptor Coactivator 4; RFG; anti-NCOA4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 100000
• Specificity: Recognizes NCOA4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-NCOA4 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NCOA4 (NP_005428, 505aa-614aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NCOA4 monoclonal antibody (M03), clone 1E5 Western Blot analysis of NCOA4 expression in Hela S3 NE (Cat # L013V3).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NCOA4 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NCOA4 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NCOA4 is approximately 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-NCOA4 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 14149617
• NCBI GeneID: 8031
• NCBI Accession #: NP_005428
• NCBI GenBank Nucleotide #: NM_005437
• UniProt Accession #: Q13772
• Molecular Weight: 70kDa
• NCBI Official Full Name: nuclear receptor coactivator 4 isoform 3
• NCBI Official Synonym Full Names: nuclear receptor coactivator 4
• NCBI Official Symbol: NCOA4
• NCBI Official Synonym Symbols: RFG; ELE1; PTC3; ARA70
• NCBI Protein Information: nuclear receptor coactivator 4
• UniProt Protein Name: Nuclear receptor coactivator 4
• Protein Family: Nuclear receptor coactivator
• UniProt Gene Name: NCOA4
• UniProt Synonym Gene Names: ARA70; ELE1; RFG; NCoA-4; 70 kDa AR-activator
• UniProt Entry Name: NCOA4_HUMAN

NCBI Description

This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq, Feb 2009]

Uniprot Description

NCOA4: Enhances the androgen receptor transcriptional activity in prostate cancer cells. Ligand-independent coactivator of the peroxisome proliferator-activated receptor (PPAR) gamma. Defects in NCOA4 are a cause of thyroid papillary carcinoma (TPC). TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. A chromosomal aberration involving NCOA4 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q11.2) generates the RET/NCOA4 (PTC3) oncogene that has been found in sporadic and radiation-associated post-Chernobyl thyroid papillary carcinomas. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Oncoprotein

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: nucleus

Molecular Function: androgen receptor binding; transcription coactivator activity

Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; androgen receptor signaling pathway; male gonad development; response to hormone stimulus

Disease: Thyroid Carcinoma, Papillary