1,4-alpha-glucan-branching enzyme (Gbe1) Recombinant Protein | Gbe1 recombinant protein
Recombinant Mouse 1,4-alpha-glucan-branching enzyme (Gbe1)
Gene Names
Gbe1; D16Ertd536e; 2310045H19Rik; 2810426P10Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
1; 4-alpha-glucan-branching enzyme (Gbe1); Recombinant Mouse 1; Gbe1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-702, Full length protein
Sequence
MAAPAAPAAGETGPDARLEAALADVPELARLLEIDPYLKPFAADFQRRYKKFSQVLHDIGENEGGIDKFSRGYESFGIHRCSDGGIYCKEWAPGAEGVFLTGEFSGWNPFSHPYKKLEYGKWELYIPPKQNKSPLIPHGSKLKVVITSKSGEILYRISPWAKYVVRENNNVNYDWIHWAPEDPYKFKHSRPKKPRSLRIYESHVGISSHEGKIASYKHFTSNVLPRIKDLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGTPEELKELVDTAHSMGIVVLLDVVHSHASKNSEDGLNMFDGTDSCYFHSGPRGTHDLWDSRLFIYSSWEVLRFLLSNIRWWLEEYCFDGFRFDGVTSMLYHHHGMGQGFSGDYNEYFGLQVDEDALIYLMLANHLAHTLYPDSITIAEDVSGMPALCSPTSQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGNIVYTLTNRRYLEKCVAYAESHDQALVGDKTLAFWLMDAEMYTNMSVLAPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFNLTDDDLLRYKFLNNFDRDMNRLEERCGWLSAPQAYVSEKHEANKTITFERAGLLFIFNFHPSKSYTDYRVGTATPGKFKIVLDSDAAEYGGHQRLDHNTNYFAEAFEHNGRPYSLLVYIPSRVALILQNVDLQN
Sequence Length
702
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Gbe1 recombinant protein
This protein is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersen s disease).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,364 Da
NCBI Official Full Name
1,4-alpha-glucan-branching enzyme
NCBI Official Synonym Full Names
glucan (1,4-alpha-), branching enzyme 1
NCBI Official Symbol
Gbe1
NCBI Official Synonym Symbols
D16Ertd536e; 2310045H19Rik; 2810426P10Rik
NCBI Protein Information
1,4-alpha-glucan-branching enzyme
UniProt Protein Name
1,4-alpha-glucan-branching enzyme
Protein Family
UniProt Gene Name
Gbe1
Uniprot Description
Required for normal glycogen accumulation. The alpha 1-6 branches of glycogen play an important role in increasing the solubility of the molecule.
Research Articles on Gbe1
Similar Products
Product Notes
The Gbe1 gbe1 (Catalog #AAA1300493) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-702, Full length protein. The amino acid sequence is listed below: MAAPAAPAAG ETGPDARLEA ALADVPELAR LLEIDPYLKP FAADFQRRYK KFSQVLHDIG ENEGGIDKFS RGYESFGIHR CSDGGIYCKE WAPGAEGVFL TGEFSGWNPF SHPYKKLEYG KWELYIPPKQ NKSPLIPHGS KLKVVITSKS GEILYRISPW AKYVVRENNN VNYDWIHWAP EDPYKFKHSR PKKPRSLRIY ESHVGISSHE GKIASYKHFT SNVLPRIKDL GYNCIQLMAI MEHAYYASFG YQITSFFAAS SRYGTPEELK ELVDTAHSMG IVVLLDVVHS HASKNSEDGL NMFDGTDSCY FHSGPRGTHD LWDSRLFIYS SWEVLRFLLS NIRWWLEEYC FDGFRFDGVT SMLYHHHGMG QGFSGDYNEY FGLQVDEDAL IYLMLANHLA HTLYPDSITI AEDVSGMPAL CSPTSQGGGG FDYRLAMAIP DKWIQLLKEF KDEDWNMGNI VYTLTNRRYL EKCVAYAESH DQALVGDKTL AFWLMDAEMY TNMSVLAPFT PVIDRGIQLH KMIRLITHGL GGEGYLNFMG NEFGHPEWLD FPRKGNNESY HYARRQFNLT DDDLLRYKFL NNFDRDMNRL EERCGWLSAP QAYVSEKHEA NKTITFERAG LLFIFNFHPS KSYTDYRVGT ATPGKFKIVL DSDAAEYGGH QRLDHNTNYF AEAFEHNGRP YSLLVYIPSR VALILQNVDL QN. It is sometimes possible for the material contained within the vial of "1,4-alpha-glucan-branching enzyme (Gbe1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
