Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (85.03kD).)

Mouse anti-Human KPNA5 Monoclonal Antibody | anti-KPNA5 antibody

KPNA5 (Importin Subunit alpha-6, Karyopherin Subunit alpha-5) (HRP)

Gene Names
KPNA5; SRP6; IPOA6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KPNA5; Monoclonal Antibody; KPNA5 (Importin Subunit alpha-6; Karyopherin Subunit alpha-5) (HRP); anti-KPNA5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D2
Specificity
Recognizes human KPNA5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-KPNA5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-539 from human KPNA5 (AAH47409.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (85.03kD).)

Western Blot (WB) (Western Blot detection against Immunogen (85.03kD).)

Western Blot (WB)

(KPNA5 monoclonal antibody Western Blot analysis of KPNA5 expression in HepG2.)

Western Blot (WB) (KPNA5 monoclonal antibody Western Blot analysis of KPNA5 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of KPNA5 expression in transfected 293T cell line by KPNA5 monoclonal antibody. Lane 1: KPNA5 transfected lysate (60.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KPNA5 expression in transfected 293T cell line by KPNA5 monoclonal antibody. Lane 1: KPNA5 transfected lysate (60.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged KPNA5 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KPNA5 is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of KPNA5 over-expressed 293 cell line, cotransfected with KPNA5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KPNA5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of KPNA5 over-expressed 293 cell line, cotransfected with KPNA5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KPNA5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-KPNA5 antibody
The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.
Product Categories/Family for anti-KPNA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
60,349 Da
NCBI Official Full Name
Homo sapiens karyopherin alpha 5 (importin alpha 6), mRNA
NCBI Official Synonym Full Names
karyopherin subunit alpha 5
NCBI Official Symbol
KPNA5
NCBI Official Synonym Symbols
SRP6; IPOA6
NCBI Protein Information
importin subunit alpha-6

NCBI Description

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus. [provided by RefSeq, Jul 2008]

Research Articles on KPNA5

Similar Products

Product Notes

The KPNA5 (Catalog #AAA6153243) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KPNA5 (Importin Subunit alpha-6, Karyopherin Subunit alpha-5) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KPNA5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KPNA5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KPNA5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.