Secreted frizzled-related protein 3 (FRZB) Recombinant Protein | FRZB recombinant protein
Recombinant Chicken Secreted frizzled-related protein 3 (FRZB)
Gene Names
FRZB; Frzb-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Secreted frizzled-related protein 3 (FRZB); Recombinant Chicken Secreted frizzled-related protein 3 (FRZB); FRZB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-315, Full length protein
Sequence
GRAAACEPVRIPLCKPLPWNMTKMPNHLHHSTQANAVLAMEQFEGLLGTNCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARAGCEPVLIRYRHAWPESLACDELPLYDRGVCISPEAIVTAEGADFPMDSNNGNCRGTGIERCKCKPIKATQKTYLRNNYNYVIRAKVKEVKTKCHDVTAVVEVKEILKSSLVNIPKDTVNLYTNSGCLCPPLSANEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDQKLRHLGKGKGEPGQSDSALKTGKPGNARQTRS
Sequence Length
294
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,004 Da
NCBI Official Full Name
secreted frizzled-related protein 3
NCBI Official Synonym Full Names
frizzled-related protein
NCBI Official Symbol
FRZB
NCBI Official Synonym Symbols
Frzb-1
NCBI Protein Information
secreted frizzled-related protein 3
UniProt Protein Name
Secreted frizzled-related protein 3
Protein Family
UniProt Gene Name
FRZB
UniProt Synonym Gene Names
SFRP3; sFRP-3
Uniprot Description
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appears to be involved in limb skeletogenesis. Antagonist of Wnt8 signaling. Regulates chondrocyte maturation and long bone development.
Research Articles on FRZB
Similar Products
Product Notes
The FRZB frzb (Catalog #AAA1297994) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-315, Full length protein. The amino acid sequence is listed below: GRAAACEPVR IPLCKPLPWN MTKMPNHLHH STQANAVLAM EQFEGLLGTN CSPDLLFFLC AMYAPICTID FQHEPIKPCK SVCERARAGC EPVLIRYRHA WPESLACDEL PLYDRGVCIS PEAIVTAEGA DFPMDSNNGN CRGTGIERCK CKPIKATQKT YLRNNYNYVI RAKVKEVKTK CHDVTAVVEV KEILKSSLVN IPKDTVNLYT NSGCLCPPLS ANEEYIIMGY EDEERSRLLL VEGSIAEKWK DRLGKKVKRW DQKLRHLGKG KGEPGQSDSA LKTGKPGNAR QTRS. It is sometimes possible for the material contained within the vial of "Secreted frizzled-related protein 3 (FRZB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
