Glutathione S-transferase F8, chloroplastic (GSTF8) Recombinant Protein | GSTF8 recombinant protein
Recombinant Arabidopsis thaliana Glutathione S-transferase F8, chloroplastic (GSTF8)
Gene Names
GSTF8; Arabidopsis thaliana glutathione S-transferase phi 8; ATGSTF5; ATGSTF8; F17A22.12; GLUTATHIONE S-TRANSFERASE (CLASS PHI) 5; GLUTATHIONE S-TRANSFERASE 16; glutathione S-transferase phi 8; GST6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutathione S-transferase F8; chloroplastic (GSTF8); Recombinant Arabidopsis thaliana Glutathione S-transferase F8; GSTF8 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
50-263, Full length protein
Sequence
ASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGMFGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFDSRPKVSEWIKKISARPAWAKVIDLQKQ
Sequence Length
214
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,077 Da
NCBI Official Full Name
glutathione S-transferase phi 8
NCBI Official Symbol
GSTF8
NCBI Official Synonym Symbols
Arabidopsis thaliana glutathione S-transferase phi 8; ATGSTF5; ATGSTF8; F17A22.12; GLUTATHIONE S-TRANSFERASE (CLASS PHI) 5; GLUTATHIONE S-TRANSFERASE 16; glutathione S-transferase phi 8; GST6
NCBI Protein Information
glutathione S-transferase phi 8
UniProt Protein Name
Glutathione S-transferase F8, chloroplastic
Protein Family
UniProt Gene Name
GSTF8
UniProt Synonym Gene Names
GST6; GSTF5; AtGSTF8
NCBI Description
Encodes glutathione transferase belonging to the phi class of GSTs. Naming convention according to Wagner et al. (2002).
Uniprot Description
In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and glutathione peroxidase activity toward cumene hydroperoxide and linoleic acid-13-hydroperoxide. May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.
Research Articles on GSTF8
Similar Products
Product Notes
The GSTF8 gstf8 (Catalog #AAA1297750) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 50-263, Full length protein. The amino acid sequence is listed below: ASIKVHGVPM STATMRVLAT LYEKDLQFEL IPVDMRAGAH KQEAHLALNP FGQIPALEDG DLTLFESRAI TQYLAEEYSE KGEKLISQDC KKVKATTNVW LQVEGQQFDP NASKLAFERV FKGMFGMTTD PAAVQELEGK LQKVLDVYEA RLAKSEFLAG DSFTLADLHH LPAIHYLLGT DSKVLFDSRP KVSEWIKKIS ARPAWAKVID LQKQ. It is sometimes possible for the material contained within the vial of "Glutathione S-transferase F8, chloroplastic (GSTF8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
