Apoptosis-inducing factor 1, mitochondrial (Aifm1) Recombinant Protein | Aifm1 recombinant protein

Recombinant Rat Apoptosis-inducing factor 1, mitochondrial (Aifm1)

Cat. Num. AAA1290961

• Gene Names: Aifm1; Aif; Pdcd8
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Apoptosis-inducing factor 1; mitochondrial (Aifm1); Recombinant Rat Apoptosis-inducing factor 1; Aifm1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 102-612, full length protein
• Sequence: GLSPEEKQRRAIASAAEGGSVPPIRVPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPEYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGKLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSDPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
• Sequence Length: 511

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Aifm1 recombinant protein

This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Several alternative transcripts encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 25742626
• NCBI GeneID: 83533
• NCBI Accession #: NP_112646.1
• NCBI GenBank Nucleotide #: NM_031356.1
• UniProt Accession #: Q9JM53; Q548E3
• Molecular Weight: 66,723 Da
• NCBI Official Full Name: apoptosis-inducing factor 1, mitochondrial
• NCBI Official Synonym Full Names: apoptosis inducing factor, mitochondria associated 1
• NCBI Official Symbol: Aifm1
• NCBI Official Synonym Symbols: Aif; Pdcd8
• NCBI Protein Information: apoptosis-inducing factor 1, mitochondrial
• UniProt Protein Name: Apoptosis-inducing factor 1, mitochondrial
• UniProt Gene Name: Aifm1
• UniProt Synonym Gene Names: Aif; Pdcd8

NCBI Description

may facilitate apoptotic chromatin condensation and DNA degradation [RGD, Feb 2006]

Uniprot Description

Functions both as NADH oxidoreductase and as regulator of apoptosis. In response to apoptotic stimuli, it is released from the mitochondrion intermembrane space into the cytosol and to the nucleus, where it functions as a proapoptotic factor in a caspase-independent pathway. In contrast, functions as an antiapoptotic factor in normal mitochondria via its NADH oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e. caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G,and thereby inhibits the EIF3 machinery and protein synthesis,and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner ().