Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Apoptosis-inducing factor 1 Recombinant Protein | AIFM1 recombinant protein

Recombinant Human Apoptosis-inducing factor 1, mitochondrial

Gene Names
AIFM1; AIF; CMT2D; CMTX4; COWCK; NADMR; NAMSD; PDCD8; COXPD6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apoptosis-inducing factor 1; Recombinant Human Apoptosis-inducing factor 1; mitochondrial; Programmed cell death protein 8; AIFM1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
103-612aa; Partial
Sequence
GLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Sequence Length
274
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for AIFM1 recombinant protein
Functions both as NADH oxidoreductase and as regulator of apoptosis. In response to apoptotic stimuli, it is released from the mitochondrion intermembrane space into the cytosol and to the nucleus, where it functions as a proapoptotic factor in a caspase-independent pathway. In contrast, functions as an antiapoptotic factor in normal mitochondria via its NADH oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i. e. caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G,and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner.
Product Categories/Family for AIFM1 recombinant protein
References
Molecular characterization of mitochondrial apoptosis-inducing factor.Susin S.A., Lorenzo H.K., Zamzami N., Marzo I., Snow B.E., Brothers G.M., Mangion J., Jacotot E., Costantini P., Loeffler M., Larochette N., Goodlett D.R., Aebersold R., Siderovski D.P., Penninger J.M., Kroemer G.Nature 397:441-446(1999)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
71.6 kDa
NCBI Official Full Name
apoptosis-inducing factor 1, mitochondrial isoform AIFsh
NCBI Official Synonym Full Names
apoptosis inducing factor, mitochondria associated 1
NCBI Official Symbol
AIFM1
NCBI Official Synonym Symbols
AIF; CMT2D; CMTX4; COWCK; NADMR; NAMSD; PDCD8; COXPD6
NCBI Protein Information
apoptosis-inducing factor 1, mitochondrial
UniProt Protein Name
Apoptosis-inducing factor 1, mitochondrial
Protein Family
UniProt Gene Name
AIFM1
UniProt Synonym Gene Names
AIF; PDCD8
UniProt Entry Name
AIFM1_HUMAN

NCBI Description

This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6 (COXPD6), a severe mitochondrial encephalomyopathy, as well as Cowchock syndrome, also known as X-linked recessive Charcot-Marie-Tooth disease-4 (CMTX-4), a disorder resulting in neuropathy, and axonal and motor-sensory defects with deafness and mental retardation. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 10. [provided by RefSeq, Aug 2015]

Uniprot Description

PDCD8: Probable oxidoreductase that has a dual role in controlling cellular life and death; during apoptosis, it is translocated from the mitochondria to the nucleus to function as a proapoptotic factor in a caspase-independent pathway, while in normal mitochondria, it functions as an antiapoptotic factor via its oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e., caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G,and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase- independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner. Interacts with XIAP/BIRC4. Interacts (via N-terminus) with EIF3G (via C-terminus). Belongs to the FAD-dependent oxidoreductase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.-.-.-; Oxidoreductase; Mitochondrial; Apoptosis

Chromosomal Location of Human Ortholog: Xq26.1

Cellular Component: cytosol; mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrion; nucleus; perinuclear region of cytoplasm

Molecular Function: DNA binding; electron carrier activity; NAD(P)H oxidase activity; oxidoreductase activity, acting on NADH or NADPH; protein binding; protein dimerization activity

Biological Process: apoptosis; caspase activation; cell redox homeostasis; chromosome condensation; DNA catabolic process; mitochondrial respiratory chain complex I assembly; neuron apoptosis; neuron differentiation; positive regulation of apoptosis; positive regulation of neuron apoptosis; response to toxin

Disease: Cowchock Syndrome

Research Articles on AIFM1

Similar Products

Product Notes

The AIFM1 aifm1 (Catalog #AAA1015301) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 103-612aa; Partial. The amino acid sequence is listed below: GLTPEQKQKK AALSASEGEE VPQDKAPSHV PFLLIGGGTA AFAAARSIRA RDPGARVLIV SEDPELPYMR PPLSKELWFS DDPNVTKTLR FKQWNGKERS IYFQPPSFYV SAQDLPHIEN GGVAVLTGKK VVQLDVRDNM VKLNDGSQIT YEKCLIATGG TPRSLSAIDR AGAEVKSRTT LFRKIGDFRS LEKISREVKS ITIIGGGFLG SELACALGRK ARALGTEVIQ LFPEKGNMGK ILPEYLSNWT MEKVRREGVK VMPNAIVQSV GVSSGKLLIK LKDGRKVETD HIVAAVGLEP NVELAKTGGL EIDSDFGGFR VNAELQARSN IWVAGDAACF YDIKLGRRRV EHHDHAVVSG RLAGENMTGA AKPYWHQSMF WSDLGPDVGY EAIGLVDSSL PTVGVFAKAT AQDNPKSATE QSGTGIRSES ETESEASEIT IPPSTPAVPQ APVQGEDYGK GVIFYLRDKV VVGIVLWNIF NRMPIARKII KDGEQHEDLN EVAKLFNIHE. It is sometimes possible for the material contained within the vial of "Apoptosis-inducing factor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.