DNA dC->dU-editing enzyme APOBEC-3H (APOBEC3H) Recombinant Protein | APOBEC3H recombinant protein

Recombinant Human DNA dC->dU-editing enzyme APOBEC-3H (APOBEC3H)

Cat. Num. AAA1285683

• Gene Names: APOBEC3H; A3H; ARP10; ARP-10
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA dC->dU-editing enzyme APOBEC-3H (APOBEC3H); Recombinant Human DNA dC->dU-editing enzyme APOBEC-3H (APOBEC3H); APOBEC3H recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-200, Full length protein
• Sequence: MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPKFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKIPGVRAQGRYMDILCDAEV
• Sequence Length: 200

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 669250885
• NCBI GeneID: 164668
• NCBI Accession #: NP_001159474.2
• NCBI GenBank Nucleotide #: NM_001166002.2
• UniProt Accession #: Q6NTF7; Q5JYL9; Q6IC87; B0QYP0; B0QYP1; B7TQM5; E9PF38
• Molecular Weight: 17,782 Da
• NCBI Official Full Name: DNA dC->dU-editing enzyme APOBEC-3H isoform SV-182
• NCBI Official Synonym Full Names: apolipoprotein B mRNA editing enzyme catalytic subunit 3H
• NCBI Official Symbol: APOBEC3H
• NCBI Official Synonym Symbols: A3H; ARP10; ARP-10
• NCBI Protein Information: DNA dC->dU-editing enzyme APOBEC-3H
• UniProt Protein Name: DNA dC->dU-editing enzyme APOBEC-3H
• Protein Family: DNA dC->dU-editing enzyme
• UniProt Gene Name: APOBEC3H
• UniProt Synonym Gene Names: ARP-10; A3H

NCBI Description

This gene encodes a member of the apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3 family of proteins. The encoded protein is a cytidine deaminase that has antiretroviral activity by generating lethal hypermutations in viral genomes. Polymorphisms and alternative splicing in this gene influence its antiretroviral activity and are associated with increased resistence to human immunodeficiency virus type 1 infection in certain populations. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]

Uniprot Description

DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. The A3H-var/haplotype 2 exhibits antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Exhibits antiviral activity also against T-cell leukemia virus type 1 (HTLV-1) and may inhibit the mobility of LTR and non-LTR retrotransposons.