Western Blot (WB)
(Host: RabbitTarget Name: APOBEC3HSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human APOBEC3H Polyclonal Antibody | anti-APOBEC3H antibody
APOBEC3H Antibody - N-terminal region
Gene Names
APOBEC3H; A3H; ARP10; ARP-10
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
APOBEC3H; Polyclonal Antibody; APOBEC3H Antibody - N-terminal region; anti-APOBEC3H antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFIN
Sequence Length
200
Applicable Applications for anti-APOBEC3H antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of Human APOBEC3H
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: APOBEC3HSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: APOBEC3HSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-APOBEC3H antibody
This gene encodes a member of the apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3 family of proteins. The encoded protein is a cytidine deaminase that has antiretroviral activity by generating lethal hypermutations in viral genomes. Polymorphisms and alternative splicing in this gene influence its antiretroviral activity and are associated with increased resistence to human immunodeficiency virus type 1 infection in certain populations. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-APOBEC3H antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
DNA dC->dU-editing enzyme APOBEC-3H isoform SV-182
NCBI Official Synonym Full Names
apolipoprotein B mRNA editing enzyme catalytic subunit 3H
NCBI Official Symbol
APOBEC3H
NCBI Official Synonym Symbols
A3H; ARP10; ARP-10
NCBI Protein Information
DNA dC->dU-editing enzyme APOBEC-3H
UniProt Protein Name
DNA dC->dU-editing enzyme APOBEC-3H
Protein Family
UniProt Gene Name
APOBEC3H
UniProt Synonym Gene Names
ARP-10; A3H
UniProt Entry Name
ABC3H_HUMAN
NCBI Description
This gene encodes a member of the apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3 family of proteins. The encoded protein is a cytidine deaminase that has antiretroviral activity by generating lethal hypermutations in viral genomes. Polymorphisms and alternative splicing in this gene influence its antiretroviral activity and are associated with increased resistence to human immunodeficiency virus type 1 infection in certain populations. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]
Research Articles on APOBEC3H
Similar Products
Product Notes
The APOBEC3H apobec3h (Catalog #AAA3223305) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOBEC3H Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOBEC3H can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOBEC3H apobec3h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QFNNKRRLRR PYYPRKALLC YQLTPQNGST PTRGYFENKK KCHAEICFIN. It is sometimes possible for the material contained within the vial of "APOBEC3H, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
